Gene Information

Name : Cal7507_1623 (Cal7507_1623)
Accession : YP_007064915.1
Strain : Calothrix sp. PCC 7507
Genome accession: NC_019682
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1748927 - 1749742 bp
Length : 816 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: npu:Npun_F4214

DNA sequence :
ATGCTTGATCAAGCAATTCACAGTCTTAAATACCAGCACAAACCCGAAATTTTTGTGATATCAATGTACACCAGCGAATC
GACTAAGTTTTCTGCCAGAGCGGACATAGGACAAACAAGCCGCATTCTTGTAGTAGAAGATGAAGAACTAATCAGGGAAA
TGTTAGTTGTGGCATTGGAAGAGGAAGGTTATGGAGTAGTCACAGCTACTGATGGGCGGATGGCTGTAGAATATCTCAAA
AACTTTGAGCCAAACTCAGGGGAAGTCTCCTTTGACTTGGTGATTCTGGATTTGATGTTGCCACAGATCAATGGGCTGGA
CATTTGCCGCTTGCTGCGTCATCAAGGCAACCCAGTACCGATTATGATGCTAAGTGCTAAAGGTAGTGAAACTGACCGTG
TCCTGGGCTTAGAAGTGGGCGCAGATGACTATTTGACGAAGCCTTTCAGTATGCGTGAGTTGGTGGCTCGGTGTCGCGCT
CTACTCCGGCGCCAGCGCTTGAGTACTTTGCCCCAATTACCAGTATTAAAGTACAAAGATGTGACTTTGAACCCGCAAGA
GTGTCGTGTACTGGTTCGCAATCAAGAAGTGAGCTTGTCGCCTAAAGAATTCCGCCTCCTAGAACTGTTTATGAGTTATG
CGCGTCGTGTTTGGTCGCGGGAACAGTTGCTAGATCAGGTCTGGGGTCCGGATTTTGTGGGGGATAGTAAAACTGTAGAT
GTTCACATCCGCTGGCTCAGGGAAAAACTTGAGCAAGACCCTAGTCGTCCTGAGTATATTGTGACTGTGAGAGGTTTTGG
TTACAGATTTGGATAA

Protein sequence :
MLDQAIHSLKYQHKPEIFVISMYTSESTKFSARADIGQTSRILVVEDEELIREMLVVALEEEGYGVVTATDGRMAVEYLK
NFEPNSGEVSFDLVILDLMLPQINGLDICRLLRHQGNPVPIMMLSAKGSETDRVLGLEVGADDYLTKPFSMRELVARCRA
LLRRQRLSTLPQLPVLKYKDVTLNPQECRVLVRNQEVSLSPKEFRLLELFMSYARRVWSREQLLDQVWGPDFVGDSKTVD
VHIRWLREKLEQDPSRPEYIVTVRGFGYRFG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-31 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-35 46
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-34 46
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-34 46
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-34 46
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-34 46
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-34 46
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-35 46
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-34 46
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-34 46
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-35 46
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-34 46
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 6e-43 44
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-38 44
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 4e-36 44
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-28 42
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-28 42
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-28 42
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-28 42
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-28 42
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-28 42
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-28 42
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-28 42
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-35 41
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-31 43
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-33 42
Cal7507_1623 YP_007064915.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-31 42