Gene Information

Name : Cal7507_2540 (Cal7507_2540)
Accession : YP_007065801.1
Strain : Calothrix sp. PCC 7507
Genome accession: NC_019682
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2870655 - 2871260 bp
Length : 606 bp
Strand : -
Note : PFAM: Tellurium resistance protein; Bacterial stress protein; COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and putative cAMP-binding protein CABP1; InterPro IPR003325; KEGG: npu:Npun_R5983 stress protein; PFAM: Bacter

DNA sequence :
ATGGCAATTAGTCTACAGAAAGGACAGAGAATCTCGCTTTCTAAGGAAGCTCCTGGTTTAACTAAACTGATGTGCGGACT
GGGTTGGGATATAGCAAAGCGCTCTGGTGGTGGATTTTTTAGTAATTTTGGTGGTGGTAGTCAGGACTACGATTTAGATG
CATCTGTGATCTGCTTAGATGCGAATGGCAAATTAACGGCTAAAGAGAATATTATCTACTTTGGTAATCTTCAGCATGTA
TCAGGAGCAATCACTCACACAGGAGACAATTTAACTGGTGCAGGTGATGGCGATGACGAGGTGATTATTATAGATTTGTC
TCGTATACCTGACCAAATTGTCAAATTAGTTTTCGTCGTCAATATTTATGATTGTATTACCCGTAAACAGGACTTTGGTC
AAGTCGAAAATGCCTTTGTGCGCCTAGTTAATGCAGCGAACAACAAAGAATTGGCTCGATATAACCTATCAGGTAAAGAG
TATCTGGGTATGACTGGGATGATCTTAGCTGAAGTGTATCGACATAGTAATGAGTGGAAAATGGCAGCAATCGGCAATGG
TATCCGTGTCAATGGCTTAGGGGATCTTGTTTCTTCCTACTGTTGA

Protein sequence :
MAISLQKGQRISLSKEAPGLTKLMCGLGWDIAKRSGGGFFSNFGGGSQDYDLDASVICLDANGKLTAKENIIYFGNLQHV
SGAITHTGDNLTGAGDGDDEVIIIDLSRIPDQIVKLVFVVNIYDCITRKQDFGQVENAFVRLVNAANNKELARYNLSGKE
YLGMTGMILAEVYRHSNEWKMAAIGNGIRVNGLGDLVSSYC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-40 47
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 5e-27 46
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-36 45
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-36 45
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-37 45
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-34 45
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-37 44
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-37 44
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-37 43
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-25 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-25 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cal7507_2540 YP_007065801.1 stress protein BAC0389 Protein 3e-37 44
Cal7507_2540 YP_007065801.1 stress protein BAC0390 Protein 7e-36 43
Cal7507_2540 YP_007065801.1 stress protein BAC0392 Protein 6e-26 42