Gene Information

Name : Cal7507_0438 (Cal7507_0438)
Accession : YP_007063767.1
Strain : Calothrix sp. PCC 7507
Genome accession: NC_019682
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 463857 - 464531 bp
Length : 675 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: naz:Aazo_0389

DNA sequence :
ATGACGCACATCTTACTGGTTGAAGATGAAGTCAAACTAGCGCGATTCGTAGAATTAGAGCTAAATTATGAAGGCTATCA
AGTTAGCATTGCTTATGATGGCTTAACTGCACTCACCGCAGCGCGGGAGTTAAATCCGGATTTAGTAATTTTAGATTGGA
TGTTGCCTGGTTTGTCGGGGTTAGAAATCTGCCGTCGCTTGCGAAGTACGGGTGACAAAGTACCGATAATTTTATTAACC
GCTAAAGATGAAGTGAGCGATCGCGTTGCTGGTTTAAATGCTGGTGCTGATGATTATGTAGTTAAACCCTTCAGTGTCGA
GGAATTAATCGCCAGAGTCCGTGCCCACTTGCGAAGAAACCAGGAAGCAGACGCCGCAGACATATTAGAATTTGAAGACT
TGAGTCTAAATCGTCGCACGCGGGAAGTATTTCGGGGTGAGCGGTTAATTGAGTTAACAGCGAAAGAATTTGATTTATTG
GATTATTTACTAGCCCATCCGCGACAGGTAATTACACGCGATCGCATCTTAGAAGAAGTCTGGGGTTATGACTTCATGGG
CGATTCTAACATCATCGAAGTCTATATTCGCTATTTGCGCCTAAAACTCGAAGCCAACAACGAAAAGCGCCTTCTGCAAA
CTGTGCGCGGTGTCGGCTATGTTTTGCGCGATTAA

Protein sequence :
MTHILLVEDEVKLARFVELELNYEGYQVSIAYDGLTALTAARELNPDLVILDWMLPGLSGLEICRRLRSTGDKVPIILLT
AKDEVSDRVAGLNAGADDYVVKPFSVEELIARVRAHLRRNQEADAADILEFEDLSLNRRTREVFRGERLIELTAKEFDLL
DYLLAHPRQVITRDRILEEVWGYDFMGDSNIIEVYIRYLRLKLEANNEKRLLQTVRGVGYVLRD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-34 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-34 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-50 50
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-50 50
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-50 50
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-44 50
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-50 50
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-50 50
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-50 50
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-50 50
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-50 50
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-39 48
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-44 45
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator BAC0308 Protein 6e-39 45
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-40 45
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-43 45
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-43 45
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-43 45
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-43 45
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-43 45
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-43 45
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-43 45
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-43 45
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-43 45
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-43 45
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator BAC0347 Protein 6e-36 44
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-35 44
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-37 43
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-37 43
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-36 42
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-35 42
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-27 42
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-32 42
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 4e-41 41
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-36 41
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 5e-31 41
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 5e-31 41
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 5e-31 41
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-33 41
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 3e-34 41
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 8e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-56 55
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator VFG0596 Protein 8e-35 46
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator VFG1389 Protein 7e-42 46
Cal7507_0438 YP_007063767.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-47 44