Gene Information

Name : Cal7507_0470 (Cal7507_0470)
Accession : YP_007063799.1
Strain : Calothrix sp. PCC 7507
Genome accession: NC_019682
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 498862 - 499590 bp
Length : 729 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: ava:Ava_1878 t

DNA sequence :
TTGGAAAGTCATAAAGAAAAAATCCTGGTGGTAGACGACGAAGCCAGCATTCGCCGGATTTTGGAAACGCGCCTTTCCAT
GATTGGCTACGATGTTGTGACGGCTGGCGACGGTGAGGAAGCTTTGGAAACTTTTCGTAAATCTGATCCTGACCTTGTAG
TCTTGGATGTGATGATGCCAAAGCTAGATGGCTACGGTGTATGCCAAGAATTACGTAAAGAATCTGATGTCCCAATTATC
ATGCTAACAGCCTTGGGCGACGTTGCCGATCGCATCACCGGGCTAGAATTGGGTGCTGATGACTATGTAGTTAAGCCATT
CTCCCCCAAAGAACTAGAAGCTCGTATCCGCTCAGTACTGCGGCGGGTAGACAAAACAGGCGCTTCTGGTATTCCTAGTT
CTGGAGTCATTCATGTCGGTAATATCAAAATCGATACGAATAAGCGACAAGTCTATAAAGGCGATGAGCGCATTCGCCTG
ACAGGTATGGAGTTTAGCCTACTAGAGTTGTTAGTGAGCCGCTCTGGTGAAGCTTTTTCCCGTTCAGAAATTTTGCAAGA
AGTGTGGGGTTACACACCAGAACGCCACGTGGACACCCGTGTGGTAGATGTGCATATCTCCCGTTTGCGAGCCAAGTTAG
AAGATGATCCCAGTAACCCAGAATTAATACTCACAGCCCGAGGTACTGGTTATTTGTTTCAACGGATAATCGAACCAGGG
GAGGAGTGA

Protein sequence :
MESHKEKILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALETFRKSDPDLVVLDVMMPKLDGYGVCQELRKESDVPII
MLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVDKTGASGIPSSGVIHVGNIKIDTNKRQVYKGDERIRL
TGMEFSLLELLVSRSGEAFSRSEILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPELILTARGTGYLFQRIIEPG
EE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-30 42
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 8e-37 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-47 49
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-47 49
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-47 49
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-47 49
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-47 49
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-47 49
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-47 49
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-47 49
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-47 49
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-47 49
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-44 47
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-39 46
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-43 46
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-42 45
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator BAC0083 Protein 9e-37 43
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 7e-38 42
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-25 42
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-28 42
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 7e-39 42
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-36 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-36 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-36 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-36 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-36 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-36 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-36 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-36 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-36 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 3e-34 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-28 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 3e-29 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-40 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-34 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-28 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 1e-28 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator BAC0533 Protein 3e-29 41
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 4e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator VFG1390 Protein 8e-40 44
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-33 43
Cal7507_0470 YP_007063799.1 winged helix family two component transcriptional regulator VFG0596 Protein 9e-31 42