Gene Information

Name : Chro_3608 (Chro_3608)
Accession : YP_007092927.1
Strain : Chroococcidiopsis thermalis PCC 7203
Genome accession: NC_019695
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4036996 - 4037670 bp
Length : 675 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR005829:IPR001789:IPR001867; KEGG: ava:

DNA sequence :
GTGACAGCACATATTCTCCTAGTTGAAGATGAAGTCAAACTGGCTCGATTCCTGGAACTGGAATTGAACAGCGAAGGTTA
TTGCGTCAGCGTAGCGCACGATGGTGTGGCAGGACTGACTTTAGCACGAGAGTCAGCTTTCGATCTGGCAATTCTGGATT
GGATGCTACCAGGGTTAACTGGAGTGGAACTATGTCGTCGTCTGCGTGCTACTGGCAACAAGATCCCCGTGATTTTATTA
ACGGCAAGAGATGAGGTAGGCGATCGCGTTGCTGGATTGGATGCTGGTGCTGATGACTACGTAGTTAAACCATTCAGCAT
TGAGGAATTACTTGCCCGAATTCGCGCCCATCTGCGCCGTACCAGCGAACCAGACTTAGATTTGATGCAATTTGAGGATT
TAAGCTTGAATCGCCGAACTCGCGAAGTGTTGCGCGGTCAACGAGCAATTGAGCTAACTGTCAAAGAATTCGATCTACTA
GAATACCTCCTCAGCCATCCGCGTCAGGTATTTACCAGAGACCAAATTTTAGAAAAGGTTTGGGGTTATGACTTTGTAGG
CGATTCCAACGTGATTGAAGTTTATATTCGCTACCTGCGCCTGAAACTGGAAGAAAACAACGAAAAGCGTTTGCTCCACA
CCGTGCGTGGTGTCGGCTATGTATTGCGAGAGTAA

Protein sequence :
MTAHILLVEDEVKLARFLELELNSEGYCVSVAHDGVAGLTLARESAFDLAILDWMLPGLTGVELCRRLRATGNKIPVILL
TARDEVGDRVAGLDAGADDYVVKPFSIEELLARIRAHLRRTSEPDLDLMQFEDLSLNRRTREVLRGQRAIELTVKEFDLL
EYLLSHPRQVFTRDQILEKVWGYDFVGDSNVIEVYIRYLRLKLEENNEKRLLHTVRGVGYVLRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-31 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-30 46
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 6e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-45 50
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-45 50
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-45 50
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-45 50
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-45 50
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-42 50
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-45 50
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-45 50
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-45 50
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-41 50
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator BAC0083 Protein 7e-37 47
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-35 45
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator BAC0197 Protein 8e-34 45
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator BAC0638 Protein 4e-31 45
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator BAC0125 Protein 4e-37 44
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-34 43
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator BAC0111 Protein 5e-36 43
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-34 43
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-25 41
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator BAC0288 Protein 1e-30 41
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 6e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator VFG1390 Protein 9e-50 55
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-34 48
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-31 46
Chro_3608 YP_007092927.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-38 44