Gene Information

Name : Cha6605_5202 (Cha6605_5202)
Accession : YP_007099620.1
Strain : Chamaesiphon minutus PCC 6605
Genome accession: NC_019697
Putative virulence/resistance : Resistance
Product : putative stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5489509 - 5490117 bp
Length : 609 bp
Strand : +
Note : PFAM: Tellurium resistance protein; Bacterial stress protein

DNA sequence :
ATGGCAATAAGTCTGCAAAAAGGACAACGAATTTCATTATCTAAAGAAGCACCAGGACTGAGCAAAATTATTTGCGGATT
GGGTTGGGATGTCATCAAACCTGCTGGTGGTGGATTTTTTAGTAATTTTGGTAACAAAGCAGGTCAAGAGTACGATCTCG
ATGCTTCGGTAATTTGCCTCAGTGATAATGGCAAGTTAACTGATAACCAAAATATCATTTACTTTGGCAATCTCAGTCAT
CCTTCAGGTGCGATCGTCCATCAAGGCGATAATCTCACTGGTGCAGGTGACGGAGATGATGAAATAATTATTATCGATTT
GGCACGGATTCCTTCTAGTATTACTAAACTAGTATTCGTGGTAAATATCTATGATTGTCAAGCTCGCAAGCAAGATTTTA
GTAAAATTGAAAATGCTTTTGTGCGCCTAGTTAATGTCGCAAATAATCAAGAATTGGCGAGATTTAATCTCTCTGGTCAA
GATTATCAAGGGATGACTGGTATGATTCTAGCTGAGGTCTATCGTCACAATGACGAATGGAAAATGGCCGCGATTGGCAA
TGGTGTTAGTGTCAATGGGCTGGGCGAACTAGTCAAATCTTATATCTAG

Protein sequence :
MAISLQKGQRISLSKEAPGLSKIICGLGWDVIKPAGGGFFSNFGNKAGQEYDLDASVICLSDNGKLTDNQNIIYFGNLSH
PSGAIVHQGDNLTGAGDGDDEIIIIDLARIPSSITKLVFVVNIYDCQARKQDFSKIENAFVRLVNVANNQELARFNLSGQ
DYQGMTGMILAEVYRHNDEWKMAAIGNGVSVNGLGELVKSYI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-32 47
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-34 46
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-34 46
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-34 46
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-35 45
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-33 45
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-33 45
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-27 44
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-33 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cha6605_5202 YP_007099620.1 putative stress response protein, TerZ- and CABP1 BAC0390 Protein 6e-34 44
Cha6605_5202 YP_007099620.1 putative stress response protein, TerZ- and CABP1 BAC0389 Protein 8e-33 44