Gene Information

Name : Pse7367_1311 (Pse7367_1311)
Accession : YP_007102033.1
Strain : Pseudanabaena sp. PCC 7367
Genome accession: NC_019701
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1675557 - 1676309 bp
Length : 753 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: amr:AM1_5663 t

DNA sequence :
TTGGAAAGTCGCAAGGAAAAAATATTGGTAGTTGATGACGAAGCTAGCATTCGTCGGATCTTGGAAACAAGGCTTTCTAT
GATTGGCTATGAGGTTGTCACGGCTGCTGATGGTGAAGAGGCGATCGACATGTTCCACCATGAGATTCCTGATTTAGTGG
TTTTGGATGTGATGATGCCTAAGCTAGATGGCTATGGTGTTTGCCAGGAGCTACGCAAGGAATCAGACATCCCAATTATT
ATGCTGACCGCGCTTGGTGATGTGGCCGATCGCATTACTGGCCTGGAACTGGGCGCAGATGATTATGTGGTCAAGCCATT
TTCGCCCAAGGAGCTAGAAGCCAGGATTCGATCGGTGCTGCGCCGGGTTGAACGCAATGGCACTTCTGGCATTCCCAGTT
CTGGGGTGATTCAAATTGGCAATATCCGGATCGACACAAACAAGCGCCAGGTTTATAAGGGCGATGAACGGATTCGGCTG
ACCGGGATGGAATTTAGCTTGCTAGAGCTGCTGGTGGGTAAGTCGGGCGAGGCATTTTCTCGATCGGACATTTTGCAAGA
AGTGTGGGGTTATACACCGGAGCGCCACGTTGATACCAGAGTGGTCGATGTCCATATTTCCCGCCTGCGTGCCAAGCTAG
AGGAAGACCCTAGTAATCCAGAATTAATCCTCACCGCCAGAGGTACTGGCTACTTGTTCCAGCGCATTACGGAACCAGCC
GATGAGGAAAAGCAAAAAAACAAAGCGGTTTAG

Protein sequence :
MESRKEKILVVDDEASIRRILETRLSMIGYEVVTAADGEEAIDMFHHEIPDLVVLDVMMPKLDGYGVCQELRKESDIPII
MLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVERNGTSGIPSSGVIQIGNIRIDTNKRQVYKGDERIRL
TGMEFSLLELLVGKSGEAFSRSDILQEVWGYTPERHVDTRVVDVHISRLRAKLEEDPSNPELILTARGTGYLFQRITEPA
DEEKQKNKAV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-31 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-47 49
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-47 49
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-47 49
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-47 49
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-47 49
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-47 49
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-47 49
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-47 49
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-47 49
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-47 48
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-42 46
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-43 46
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-38 45
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-42 45
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 5e-40 44
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator BAC0083 Protein 6e-37 43
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator BAC0638 Protein 4e-28 42
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-36 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-36 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-36 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-36 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-36 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-36 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-36 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-36 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 2e-35 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 4e-39 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 3e-33 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 4e-31 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 3e-32 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 7e-26 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-33 41
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-41 44
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-32 42
Pse7367_1311 YP_007102033.1 winged helix family two component transcriptional regulator VFG0596 Protein 4e-31 41