Gene Information

Name : Pse7367_2796 (Pse7367_2796)
Accession : YP_007103477.1
Strain : Pseudanabaena sp. PCC 7367
Genome accession: NC_019701
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3523361 - 3524038 bp
Length : 678 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: cyc:PCC7424_22

DNA sequence :
ATGACATCGCAAATTTTGATTATCGAAGACGAAGAAAAGCTAGCCCAGTTTGTGCAAATGGAGCTGGAGTATGAAGGCTA
TAAGGTCACGGTAGCAAATGATGGCATGAATGGCTTGATGCAGGCACGGAATGCTAACCATGATTTGATCATTATGGATT
GGATGATGCCAGGGATTTCTGGCCTAGAAATGTGTCGCCGCCTCCGCCAAACTGGCAATAAGGTGCCGATTATTATGGTG
ACAGCACGGGACGAGATTAAAGATCGCGTGGCTGGTCTGGATGCGGGCGCGGATGATTATGTGGTCAAGCCGTTCAGCAT
TGAAGAATTATTGGCACGTGTACGGGTGAATTTACGCCGAACCAAAGGAGAAAACAGCGATCGCCTGGAGTTTGATGATC
TCAAGCTCGATCGCCGCACCAGGGAAGTATTTCGGGGCGATCGTAAAATTGAGCTTACTGCCAAGGAATTTGACCTGCTG
GAATATTTGCTCGATCATCCCCAACAGGTGCTAACCCGCGATCGGATTCTGGAAAACGTCTGGGGCTATGACTTTATGGG
CGATTCCAACATCATTGAAGTCTATATTCGCTATTTGCGCCTGAAGCTGGAAGCCAACCAAGAACCCCGCATGATCCAAA
CTGTGCGCGGGGTGGGCTATGCGCTGCGCTATTCTTAA

Protein sequence :
MTSQILIIEDEEKLAQFVQMELEYEGYKVTVANDGMNGLMQARNANHDLIIMDWMMPGISGLEMCRRLRQTGNKVPIIMV
TARDEIKDRVAGLDAGADDYVVKPFSIEELLARVRVNLRRTKGENSDRLEFDDLKLDRRTREVFRGDRKIELTAKEFDLL
EYLLDHPQQVLTRDRILENVWGYDFMGDSNIIEVYIRYLRLKLEANQEPRMIQTVRGVGYALRYS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-36 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-35 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-49 49
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-49 49
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-49 49
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-49 49
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-49 49
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-49 49
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-49 49
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-49 49
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-45 49
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-45 48
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-41 46
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator BAC0111 Protein 9e-42 44
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-37 44
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 4e-44 43
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-42 43
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-42 43
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator BAC0125 Protein 6e-42 43
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-42 43
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-35 43
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 4e-38 43
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-41 42
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-41 42
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator BAC0347 Protein 4e-38 42
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-41 42
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-41 42
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-41 42
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-41 42
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-41 42
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-41 42
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-30 42
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-33 41
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 8e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-56 53
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator VFG0596 Protein 4e-36 44
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-41 44
Pse7367_2796 YP_007103477.1 winged helix family two component transcriptional regulator VFG1386 Protein 8e-48 42