Gene Information

Name : Osc7112_6250 (Osc7112_6250)
Accession : YP_007118842.1
Strain : Oscillatoria nigro-viridis PCC 7112
Genome accession: NC_019729
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 7475645 - 7476214 bp
Length : 570 bp
Strand : -
Note : PFAM: Bacterial stress protein; COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and putative cAMP-binding protein CABP1; InterPro IPR003325; KEGG: ter:Tery_0707 stress protein; PFAM: Bacterial stress protein; SPTR: Stres

DNA sequence :
ATGTCTATCAATTTGGAAAAAGGCGGGAGAATCAATCTCTCTAAAGAAGCACCGGGGTTGAAAAATGCCGGAATTGGTTT
GGGATGGGATCTCAACGCTACAGACACCGGCGCAGCGTTTGACTTAGATGCTTCCGTGTTTATGTTGGGGGCTACTGGCA
AAATCCCCAGCGAAAAATACTTTGTTTTCTACAACAACAACCAATCGCCGGACACTTCTGTAATACATCTGGGAGATAGC
AGAACCGGAGAAGGATTTGGCGATGATGAAACCGTTACAGTCGATTTAACCAAAGTCGATCCGGCGGTGCAAGAAATTGT
GTTTGTGGTAACTATCCACGAAGCAGAATCGAGAAGGCAAAACTTCGGTCAAGTGCGAAATGCTTTTATCAGGATTTACG
ACACTACTACGAACACAGAGGTAACGAAGTACGATTTGGACGAGGATTTTTCTAGGGAGACAGCGGTAGAGTTTGGCAGA
CTTTACAAGAAAGACGGCGAGTGGAGGTTCCAAGCTGTAGGACAAGGTTACAATTCCGGCTTGCAAAGCTTTGTAGACAA
GTATGCCTGA

Protein sequence :
MSINLEKGGRINLSKEAPGLKNAGIGLGWDLNATDTGAAFDLDASVFMLGATGKIPSEKYFVFYNNNQSPDTSVIHLGDS
RTGEGFGDDETVTVDLTKVDPAVQEIVFVVTIHEAESRRQNFGQVRNAFIRIYDTTTNTEVTKYDLDEDFSRETAVEFGR
LYKKDGEWRFQAVGQGYNSGLQSFVDKYA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-49 56
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-49 56
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-49 55
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-49 55
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-47 52
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-48 52
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-47 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-46 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Osc7112_6250 YP_007118842.1 stress protein BAC0389 Protein 8e-49 55
Osc7112_6250 YP_007118842.1 stress protein BAC0390 Protein 6e-50 54