Gene Information

Name : Mic7113_3885 (Mic7113_3885)
Accession : YP_007123003.1
Strain : Microcoleus sp. PCC 7113
Genome accession: NC_019738
Putative virulence/resistance : Resistance
Product : stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4498396 - 4498968 bp
Length : 573 bp
Strand : -
Note : PFAM: Bacterial stress protein

DNA sequence :
ATGTCGATTAATCTAAGCAAAGGTGAAAGAATCAATCTTTCAAAAGAAGCACCTGGAATGAAACTTGCAGGAATAGGTTT
GGGCTGGGATATTAACCAGACAGATACAGGCGCGGGGTTTGACTTAGATGCTTCTGTATTTATGTTAGGAGCTAATGGAA
AAATTCCTAACGATAAATACTTCGTATTCTACAACAACTCAGCATCGCCTGATGGTTCTGTAAAATATCAGGGAGATAGC
AGAACTGGAGAGGGCGCAGGAGATGATGAGACGGTTGAAATTGATTTGACTAAAGTAGATGCTTCTGTTCAAGAAATAAT
TTTTGTTGTAACCATTCATGAAGCAGAGCAAAGAAGGCAAAACTTTGGTCAAGTCAGAAACTCGTTTATCAGAATTTATG
ACAATGCTACAGAAAAGCAAGTTGCCAAGTATGAGTTAGATGAGGATTTCTCACGAGAAACTGCAATTGAATTTGGTAAG
CTTTACAAAAAGGACGGTGAATGGAGATTCCAAGCCGTTGGGGCAGGCTATAATTCAGGGCTTCAGAGTTTTGTAGATAA
ATATGCCTCTTAG

Protein sequence :
MSINLSKGERINLSKEAPGMKLAGIGLGWDINQTDTGAGFDLDASVFMLGANGKIPNDKYFVFYNNSASPDGSVKYQGDS
RTGEGAGDDETVEIDLTKVDASVQEIIFVVTIHEAEQRRQNFGQVRNSFIRIYDNATEKQVAKYELDEDFSRETAIEFGK
LYKKDGEWRFQAVGAGYNSGLQSFVDKYAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-50 56
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-50 56
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-49 55
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-49 53
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-49 53
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-49 53
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-47 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-45 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mic7113_3885 YP_007123003.1 stress response protein, TerZ- and CABP1 BAC0389 Protein 3e-49 56
Mic7113_3885 YP_007123003.1 stress response protein, TerZ- and CABP1 BAC0390 Protein 8e-52 55