Gene Information

Name : Glo7428_0146 (Glo7428_0146)
Accession : YP_007125920.1
Strain : Gloeocapsa sp. PCC 7428
Genome accession: NC_019745
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 166355 - 167050 bp
Length : 696 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: amr:AM1_1480 t

DNA sequence :
ATGACAGCACATATTCTGCTAGTAGAAGACGAAATTAAGCTGGCTAAGTTCGTTCAGATGGAACTCACCTATGAAGGCTA
TCGCCTTAGCGTAGAACACGATGGATTAGCAGGGCTAATTGCAGCCCGCGAATTACATCCCGATTTAGTGATTTTAGATT
GGATGTTACCAGGGATATCAGGATTAGAAGTTTGCCGCCGCTTGCGGATTCACGGAGATAAAGTACCAATTATTTTACTC
ACTGCCAAGGATGATATTAGCGATCGCGTTGCAGGCTTAGATGCAGGTGCTGATGATTATGTTGTTAAGCCTTTTAGTGT
TGAAGAATTACTCGCAAGAGTCCGCGCACACCTACGACGTACTCAAGACATAGATCCTGATATACGCCAATTTGCAGATT
TGAAGTTAAATCGCCGCACTAGAGAAGTTTATCGAGGTACGCGATTAATTGAATTAACAGCAAAAGAATTTGACTTACTA
GAATATCTTCTGGCACATCCCCAAGAAGTGATTACGCGCGATCGCATTCTGGAAAAAGTTTGGGGGTACGACTTTATGGG
CGACTCTAACATTATTGAAGTTTATATCCGCTACTTGCGCCTCAAGCTAGAAGCCAACAAAGAACCGCGCCTCATTCAAA
CTGTGCGTAGTGTTGGTTATGTATTGCGAGAGAGGAGTGAGGGAGTGAAAGAGTGA

Protein sequence :
MTAHILLVEDEIKLAKFVQMELTYEGYRLSVEHDGLAGLIAARELHPDLVILDWMLPGISGLEVCRRLRIHGDKVPIILL
TAKDDISDRVAGLDAGADDYVVKPFSVEELLARVRAHLRRTQDIDPDIRQFADLKLNRRTREVYRGTRLIELTAKEFDLL
EYLLAHPQEVITRDRILEKVWGYDFMGDSNIIEVYIRYLRLKLEANKEPRLIQTVRSVGYVLRERSEGVKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-32 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 4e-47 50
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 4e-47 50
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 4e-47 50
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 4e-47 50
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 4e-47 50
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 4e-47 50
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 4e-47 50
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 4e-47 50
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 4e-42 49
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 1e-37 47
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-42 46
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 8e-43 46
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-42 46
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 7e-43 46
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-42 46
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-42 46
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-42 46
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-42 46
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-42 46
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-42 46
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-42 46
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family BAC0308 Protein 2e-39 45
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family BAC0197 Protein 2e-37 45
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family BAC0111 Protein 6e-39 45
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family BAC0083 Protein 2e-38 44
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-43 44
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family BAC0347 Protein 3e-36 44
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family BAC0125 Protein 1e-38 43
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 5e-35 42
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family BAC0638 Protein 2e-30 42
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 3e-31 42
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family VFG1390 Protein 2e-54 54
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family VFG0596 Protein 6e-33 44
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family VFG1386 Protein 1e-45 43
Glo7428_0146 YP_007125920.1 two component transcriptional regulator, winged helix family VFG1389 Protein 2e-39 43