Gene Information

Name : Glo7428_3039 (Glo7428_3039)
Accession : YP_007128688.1
Strain : Gloeocapsa sp. PCC 7428
Genome accession: NC_019745
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3394768 - 3395520 bp
Length : 753 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: npu:Npun_F4214

DNA sequence :
ATGTTTACTCTTGAACCAGCCAAGTGTCCTCCGAGGGCAGAAATTGGACAAATGAGCCGCATCTTAGTCGTCGAGGACGA
AGAGTTAATCCGCGAAATGCTAGTTCTCGCGCTAGAGGCTGAAGGTTATACGATCGCAACTGCTACTGATGGTAGAACAG
CATTATCTATGCTACCAACTTCCGAGGCAACTCAAGGCGAAGTACCTTATGACTTGCTGATTTTAGACTTAATGTTACCG
CAAGTGAACGGTTTAGACGTCTGTCGCCTACTGCGTCATCAAGGAAATCAAATTCCTATCCTCATTCTGAGTGCAAAAGG
TAGCGAGACAGATCGCGTTTTAGGTTTAGAAGTAGGAGCCGACGACTATCTCACCAAACCTTTTAGTATGCGCGAACTTG
TTGCTCGTTGTCGCGCTTTGTTGCGTCGCCAGCGCTTCAATAGCTTACCGCAACTCCCGCTACTCCAGTTCAAAGATGTC
ACGCTTTACTCACAAGAATGTCGCGTCACTGTACGCGGTGAAGAAGCAAGTCTTTCACCTAAAGAATTTCGTTTACTTGA
ACTATTCATGACATACCCCCGCCGCGTTTGGTCGCGCGAACAATTACTCGATCAAGTCTGGGGCGCAGATTTTATTGGAG
ACAGCAAAACCGTCGATGTTCACATCCGTTGGCTACGCGAAAAATTAGAAAAAGACCCCAGTCATCCTGAATACATCATT
ACTGTACGCGGCTTCGGCTACCGCTTTGGGTAA

Protein sequence :
MFTLEPAKCPPRAEIGQMSRILVVEDEELIREMLVLALEAEGYTIATATDGRTALSMLPTSEATQGEVPYDLLILDLMLP
QVNGLDVCRLLRHQGNQIPILILSAKGSETDRVLGLEVGADDYLTKPFSMRELVARCRALLRRQRFNSLPQLPLLQFKDV
TLYSQECRVTVRGEEASLSPKEFRLLELFMTYPRRVWSREQLLDQVWGADFIGDSKTVDVHIRWLREKLEKDPSHPEYII
TVRGFGYRFG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-36 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-42 46
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 6e-41 46
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 5e-41 46
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 5e-41 46
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 6e-41 46
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 5e-41 46
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 5e-41 46
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 5e-41 46
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 5e-41 46
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 5e-41 46
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 3e-48 45
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 1e-37 45
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 6e-41 44
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-36 43
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-36 43
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-36 43
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-36 43
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-36 43
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-36 43
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-36 43
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-36 43
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 8e-43 43
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-44 43
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 2e-21 43
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 6e-30 42
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 2e-37 42
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 7e-34 41
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family BAC0308 Protein 6e-30 41
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 6e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family VFG1563 Protein 2e-36 44
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family VFG1390 Protein 5e-41 44
Glo7428_3039 YP_007128688.1 two component transcriptional regulator, winged helix family VFG1702 Protein 2e-36 43