Gene Information

Name : Sta7437_1310 (Sta7437_1310)
Accession : YP_007131843.1
Strain : Stanieria cyanosphaera PCC 7437
Genome accession: NC_019748
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1459834 - 1460520 bp
Length : 687 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: cyc:PCC7424_13

DNA sequence :
ATGAAAATTCTTTTAGTTGATGATGAAGCAGAATTAACAGATCCCCTCAGTCGCATCTTGTCTAAGGAAGGATATCAAGT
GGATATTGCTGACAACGGAGTAACAGGAATTAATTTAGCTCTGCAAAATAACTATGATTTATTAATCCTTGATTGGATGC
TACCTCAAAGATCGGGTTTAGAAATTTGCCAAGAATTGCGATCGCGTTCTTTGACTACTCCTGTCTTGTTTCTTACTGCC
AAAGATACCATTGATGATCGGGTGATTGGTTTGGATGCAGGGGCAGATGATTATTTAGTCAAACCTTTTGAATTAAGAGA
ATTATTAGCCAGAGTTAGAGCTTTATTACGAAGAGTTACTCTTGGCGATCCTCAATTGAATGAGAAGCTGAAAGTAGCAG
ATTTAGAACTAGATAGCGAAAATCAATTAGCCTATCGTCAAGGAAGAGTGATTGACTTATCAGAAAAAGAGGTTAAGCTC
TTAGCATATTTTATGAAACATCCAGGTCAACTACTCACTCATGAGGATATTTATAGTTATTTATGGACAGACGAAGAAAA
ACCTAGTAGTAATGTTTTAGCTGCTTTAATTCGTCTTTTAAGGCGTAAAATAGAAATACCAGGTGAAATTCCTTTAATTC
ATACTGTCTACGGTAAAGGTTATCGTTTTGGTGACAACGAATTTTAA

Protein sequence :
MKILLVDDEAELTDPLSRILSKEGYQVDIADNGVTGINLALQNNYDLLILDWMLPQRSGLEICQELRSRSLTTPVLFLTA
KDTIDDRVIGLDAGADDYLVKPFELRELLARVRALLRRVTLGDPQLNEKLKVADLELDSENQLAYRQGRVIDLSEKEVKL
LAYFMKHPGQLLTHEDIYSYLWTDEEKPSSNVLAALIRLLRRKIEIPGEIPLIHTVYGKGYRFGDNEF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-23 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family BAC0347 Protein 3e-26 49
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family BAC0197 Protein 2e-26 47
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family CP001485.1.gene721.p Protein 5e-19 45
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family BAC0111 Protein 4e-26 44
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family BAC0288 Protein 5e-24 43
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family BAC0083 Protein 6e-26 43
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family BAC0125 Protein 8e-28 43
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family BAC0308 Protein 3e-21 43
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family BAC0638 Protein 4e-20 42
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 2e-17 42
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 3e-27 41
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family BAC0487 Protein 8e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family VFG1390 Protein 6e-27 44
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family VFG0596 Protein 9e-24 42
Sta7437_1310 YP_007131843.1 two component transcriptional regulator, winged helix family VFG0473 Protein 2e-19 41