Gene Information

Name : Sta7437_2445 (Sta7437_2445)
Accession : YP_007132946.1
Strain : Stanieria cyanosphaera PCC 7437
Genome accession: NC_019748
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2764241 - 2764930 bp
Length : 690 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: ava:Ava_3453 t

DNA sequence :
ATGAATGAAGTTATGCACGTCCTGTTCGTAGAAGACGAGTTAAAAATTGCCAACTTTGTCCAAGCAGGTTTAAAAGAACA
AGGATTTGTAGTTGACTATTGCGACGATGGCGATCTTGGTTATCTCAAAGCCATTAACAACGAGTATGATGCGATCGTGC
TAGATATTATGCTCCCTGGTAAAGATGGACTATTTATTCTCAAACATTTACGGCGAGAAGGAAGAAATATTCCTGTGATT
TTGTTAACGGCTCGTAATGAATTAGATGACCGACTAGAAGGGTTAAATTTGGGGGCTGATGATTATATTGCCAAACCTTT
TTTTGTTGAAGAATTAGTAGCTCGTCTTCATGCAGTAGTACGTCGTAGCGTTGGGGAAAGACAAAATCTACTTTCCGTTG
GCTTACTAACTTTAGATCGCATTACCAGAGAGGTTACTTGCGAGGAACAGATGGTTGAACTAACCACCCGCGAGTTTAAT
TTATTAGAATACTTAATGCGATCGCCTGGAAGGGTTTTTACTCGCACCCAAATTTTAGAACACGTCTGGGGTTATGATTT
TAATCCCAATACTAATGTAGTGGATGTTTGCATTCAAAGAATTAGGAAAAAGATCGATCGCTTTAATGATTCTAGTTGGA
TTGAAAGTGTGCGAGGAGTTGGTTATCGTTTTCGTAACCCAGAATCTTAA

Protein sequence :
MNEVMHVLFVEDELKIANFVQAGLKEQGFVVDYCDDGDLGYLKAINNEYDAIVLDIMLPGKDGLFILKHLRREGRNIPVI
LLTARNELDDRLEGLNLGADDYIAKPFFVEELVARLHAVVRRSVGERQNLLSVGLLTLDRITREVTCEEQMVELTTREFN
LLEYLMRSPGRVFTRTQILEHVWGYDFNPNTNVVDVCIQRIRKKIDRFNDSSWIESVRGVGYRFRNPES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-35 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family BAC0197 Protein 1e-43 47
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family BAC0125 Protein 2e-40 45
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-34 42
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family BAC0347 Protein 2e-40 42
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family BAC0111 Protein 1e-42 42
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family BAC0083 Protein 3e-40 42
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-35 41
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-35 41
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-35 41
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-35 41
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-35 41
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-35 41
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-35 41
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-35 41
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family BAC0308 Protein 4e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-35 42
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family VFG1389 Protein 1e-32 42
Sta7437_2445 YP_007132946.1 two component transcriptional regulator, winged helix family VFG1386 Protein 3e-38 41