Gene Information

Name : Cri9333_4701 (Cri9333_4701)
Accession : YP_007144990.1
Strain : Crinalium epipsammum PCC 9333
Genome accession: NC_019753
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5313429 - 5314031 bp
Length : 603 bp
Strand : -
Note : PFAM: Tellurium resistance protein; Bacterial stress protein; COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and putative cAMP-binding protein CABP1; InterPro IPR003325; KEGG: npu:Npun_R5983 stress protein; PFAM: Bacter

DNA sequence :
ATGGCAATTAATCTAGAAAAAGGTCAACGCATCTCGCTTTCTAAAGAAGCACCAGGACTAACAAAACTCATGTGCGGACT
AGGATGGGATGTAGCAAAACCTTCAGGTGGTGGTTTGTTTGGAGCCTTCAGCAATAATGTTGACTACGACCTTGATTCAT
CTGTTATTTGTTTAGATGAAAATGATAAAGCCAATAATCAGGGTAATGTCATTTATTTTAGTAATCTCCAACATAAATCA
GGAGCTATTACTCATCTAGGTGATAATCTTACGGGTGCAGGAGACGGGGACGACGAGCAAATTCTTGTGAGTTTAAATCA
GATACCAGCAGAAATTTCTAAACTGGTTTTTACTGTCAATATTTACAATTGCCTAGAACGTAAACAAGATTTTGGACAAA
TTAAAAATGCCTTTGTACGCTTGGTAAATATATCCAACAATAAAGAAATTGCTCGGTATAACTTATCAGGTCAAGAATAC
AAAGGTATGACAGGAATGATTATGGCTGAAATCTATCGGCACAATAACGAGTGGAAAATGGCAGCAATTGGTAACGGCGT
TAAAGTCAATGGTTTGGGTGAGCTTGTTAAAGCTTATGCTTAA

Protein sequence :
MAINLEKGQRISLSKEAPGLTKLMCGLGWDVAKPSGGGLFGAFSNNVDYDLDSSVICLDENDKANNQGNVIYFSNLQHKS
GAITHLGDNLTGAGDGDDEQILVSLNQIPAEISKLVFTVNIYNCLERKQDFGQIKNAFVRLVNISNNKEIARYNLSGQEY
KGMTGMIMAEIYRHNNEWKMAAIGNGVKVNGLGELVKAYA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-37 48
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-28 45
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-39 44
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-36 44
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-36 44
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-36 44
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-36 41
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cri9333_4701 YP_007144990.1 stress protein BAC0390 Protein 6e-35 41
Cri9333_4701 YP_007144990.1 stress protein BAC0389 Protein 4e-36 41