Gene Information

Name : Anacy_0517 (Anacy_0517)
Accession : YP_007155024.1
Strain : Anabaena cylindrica PCC 7122
Genome accession: NC_019771
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 634100 - 634867 bp
Length : 768 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: naz:Aazo_0389

DNA sequence :
ATGAGATGTCTAGCTATTGAGTATTTAAACATATTCTCTATAGTTATCATTCTGTGTATAATTAACATCCCTGCTGAAAT
CCTGAATATTATTATGACGCACATCTTACTGGTTGAAGATGAAGTCAAATTAGCTCGATTTATAGAGTTAGAATTGAGTT
ATGAAGGCTATCAAGTTAGTGTAGCCTATGATGGACTAACCGCCCTGACTGCGGCAAGGGAGTTAAATCTAGATTTAATA
ATTTTAGACTGGATGCTACCTGGTGTGTCGGGGTTAGAAATTTGCCGTCGCTTACGGAGTACCGGTGATAAAGTACCGAT
AATTTTATTAACCGCTAAAGATGAAGTGAGCGATCGCGTTGCTGGTTTAGATGCTGGTGCTGATGATTACGTAGTCAAAC
CATTTAGTGTCGAAGAATTATTAGCCAGAGTCCGCGCCCACCTGAGACGAAACCGGGAAACAGATACCGCAGATATCTTA
GCATTTGATGACCTAAGTTTAAATCGCCGCACGCGGGAAGTCTATCGAGGAAAGCGATTAGTAGAGTTGACTGCGAAGGA
ATTTGATTTGCTGGACTATCTACTCGCCCATCCGCGCCAGGTAATTACGCGCGATCGCATTTTAGAAGAAGTCTGGGGTT
ATGACTTCATGGGTGATTCCAACATAATTGAAGTTTATATTCGCTACTTGCGCTTGAAACTGGAAGCCAACAATGAAAAG
CGTCTCGTTCAAACTGTGCGTGGTGTCGGCTATGTATTACGCGAATAA

Protein sequence :
MRCLAIEYLNIFSIVIILCIINIPAEILNIIMTHILLVEDEVKLARFIELELSYEGYQVSVAYDGLTALTAARELNLDLI
ILDWMLPGVSGLEICRRLRSTGDKVPIILLTAKDEVSDRVAGLDAGADDYVVKPFSVEELLARVRAHLRRNRETDTADIL
AFDDLSLNRRTREVYRGKRLVELTAKEFDLLDYLLAHPRQVITRDRILEEVWGYDFMGDSNIIEVYIRYLRLKLEANNEK
RLVQTVRGVGYVLRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-34 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-34 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 8e-51 51
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 8e-51 51
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 4e-45 51
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 8e-51 51
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 8e-51 51
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 8e-51 51
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 8e-51 51
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 8e-51 51
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 8e-51 51
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-38 48
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-43 46
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family BAC0308 Protein 4e-39 45
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-41 45
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-41 45
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-41 45
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-41 45
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-41 45
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-41 45
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-41 45
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-41 45
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-41 45
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-41 45
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family BAC0347 Protein 4e-37 44
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family BAC0111 Protein 3e-38 44
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family BAC0083 Protein 2e-39 44
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family BAC0197 Protein 2e-35 44
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 3e-42 43
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family BAC0125 Protein 3e-38 43
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 4e-36 42
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 1e-29 42
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 2e-29 42
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 1e-29 42
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 1e-26 42
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family CP000034.1.gene3671. Protein 2e-35 42
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 7e-34 41
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 7e-37 41
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 3e-32 41
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family BAC0638 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family VFG1390 Protein 9e-56 56
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family VFG1389 Protein 6e-40 46
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family VFG0596 Protein 5e-35 44
Anacy_0517 YP_007155024.1 two component transcriptional regulator, winged helix family VFG1386 Protein 3e-45 44