Gene Information

Name : Cyan10605_1699 (Cyan10605_1699)
Accession : YP_007161846.1
Strain : Cyanobacterium aponinum PCC 10605
Genome accession: NC_019776
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2033717 - 2034469 bp
Length : 753 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: cyh:Cyan8802_2

DNA sequence :
ATGTTGTGTCTGGATTTACCACCAATTGGCGCTAATGAGAAAGCATCAGTCAACTATGATATTCTTGTAGTTGAAGATGA
GCAGTTGATTCGCAATATGATTGCCTTAAATCTTGCAGATGAGGGTTACAATGTAATTCAAGCAGAAAATGGCAGAGAAG
CATTAAACGTTCTTGAGCGTATTGGAGAAGAAAACTCCAAAGAAAAAATAGATCTGATTATTCTTGATTTAATGTTACCA
GAAGTCAATGGCTTAGATATTTGTCGTTTACTACGTTATCGAGGAAATAATATTCCTATCCTTATTTTGAGTGCCAAAGC
GGCTGAAACAGACAGAGTCTTGGGCTTAGAAATAGGTGCAGACGACTATGTAACTAAACCTTTCAGTATGAAAGAACTTA
TTGCTCGTTGTCGTGCCTTACTACGCCGAAATAACATCAATAACAATATCTCCAGTGCTATTCGTCAATTTAAAGATATA
ACTTTATATACAACAGAGTGTAGGGTAACTGTCAGAGGAGAAGAAGTAAGTCTTTCGCCTAAAGAATTTCGTCTTTTAGA
ACTATTTATGACTTATCCAAAAAGAGTTTGGGATAGGGAACAACTCATCGAAAATATCTGGGGTGCTGATTTTCTAGGAG
ATACAAAAACCGTTGATGTCCATATTCGTTGGCTAAGGGAAAAATTAGAGCTTGATCCTAGCAATCCTGAATATATAGTA
ACGGTAAGAGGATTTGGTTATCGTTTCGGATAA

Protein sequence :
MLCLDLPPIGANEKASVNYDILVVEDEQLIRNMIALNLADEGYNVIQAENGREALNVLERIGEENSKEKIDLIILDLMLP
EVNGLDICRLLRYRGNNIPILILSAKAAETDRVLGLEIGADDYVTKPFSMKELIARCRALLRRNNINNNISSAIRQFKDI
TLYTTECRVTVRGEEVSLSPKEFRLLELFMTYPKRVWDREQLIENIWGADFLGDTKTVDVHIRWLREKLELDPSNPEYIV
TVRGFGYRFG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-29 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 6e-37 45
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-33 44
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-33 44
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-33 44
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-33 44
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-33 44
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-33 44
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-33 44
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-33 44
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-33 44
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-33 44
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-38 43
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-27 42
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-27 42
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-27 42
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-27 42
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-27 42
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-27 42
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-27 42
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-27 42
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-35 42
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-37 42
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-34 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator VFG1702 Protein 5e-30 43
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator VFG1563 Protein 6e-30 42
Cyan10605_1699 YP_007161846.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-32 41