Gene Information

Name : PCC7418_2986 (PCC7418_2986)
Accession : YP_007169329.1
Strain : Halothece sp. PCC 7418
Genome accession: NC_019779
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3242284 - 3242958 bp
Length : 675 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR005829:IPR001789:IPR001867; KEGG: ava:

DNA sequence :
ATGACTGCTCAGATTTTAATCGTTGAAGATGAAGTCAAACTTGCCCAATTTATTGAGTTAGAACTTAAGTATGAAGGCTA
TGAGGTAATCACAGCCACTGATGGCTTCACAGGCTTATCGCAAGCGCGAGAATCCACTCCTGATTTACTGATTTTAGACT
GGATGTTACCCGGCATTTCAGGATTAGAGATTTGTCGCCGTTTACGTCAAACTGGAAGTACCGTTCCTGTAATTTTATTA
ACGGCAAAAGATGAGATCAGCGATCGCGTGGAAGGATTAGATGCAGGGGCGGATGACTATGTGGTCAAACCGTTTAGCAT
TGAAGAATTATTTGCCCGAGTCCGCGCTCATCTTCGTCGCACCCAAGAGGACGAAACCGATGTCTTACAGTTTAGCGATC
TCAAACTCAATACCAGCACCCGAGAAGTTTATCGCCGCGATCGCGCGATCGAATTAACCGCTAAAGAGTTTGAACTCCTG
CGCTATCTCCTCAACCACCCGCGTCAAGTTTTAACCCGTGACCAAATTTTAGAACGAGTCTGGGGATACGACTTTATGGG
CGATTCTAATATTATTGAAGTTTATATTCGCTATCTTAGATTAAAACTGGAAGACCAAGGAGAATCTCGGATCATTCAAA
CCGTCCGAGGCGTGGGCTACGTTTTGCGAGAATGA

Protein sequence :
MTAQILIVEDEVKLAQFIELELKYEGYEVITATDGFTGLSQARESTPDLLILDWMLPGISGLEICRRLRQTGSTVPVILL
TAKDEISDRVEGLDAGADDYVVKPFSIEELFARVRAHLRRTQEDETDVLQFSDLKLNTSTREVYRRDRAIELTAKEFELL
RYLLNHPRQVLTRDQILERVWGYDFMGDSNIIEVYIRYLRLKLEDQGESRIIQTVRGVGYVLRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-34 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-33 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-34 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-48 52
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-48 52
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-48 52
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-48 52
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-48 52
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-48 52
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-48 52
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-48 52
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 6e-45 51
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 7e-45 50
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-40 48
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-37 45
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-39 45
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-41 45
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-43 44
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-43 44
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-43 44
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-43 44
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-43 44
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-43 44
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator BAC0347 Protein 7e-38 44
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-43 44
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-43 44
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-43 44
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-43 44
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-39 44
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-42 44
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-41 44
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator BAC0125 Protein 6e-40 43
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 4e-42 42
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-34 42
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-34 42
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 9e-39 42
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 6e-26 42
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 8e-38 42
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-34 42
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-35 41
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-28 41
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-54 52
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-50 46
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-43 45
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator VFG0596 Protein 5e-35 43
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-34 41
PCC7418_2986 YP_007169329.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-34 41