Gene Information

Name : PCC7418_3128 (PCC7418_3128)
Accession : YP_007169461.1
Strain : Halothece sp. PCC 7418
Genome accession: NC_019779
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3383386 - 3384123 bp
Length : 738 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: ava:Ava_1878 t

DNA sequence :
TTGGAAAATCATAAAGAAAAAATTTTAGTCGTTGACGATGAAGCTAGCATTCGTCGTATCCTCGAAACTCGTTTGTCCAT
GATTGGCTACGATGTTGTAACAGCAGCAGATGGTGAAGAAGCCATTGCTACTTTTAACGAAAATCATCCTGATCTGGTTG
TTTTAGATGTAATGATGCCAAAACTGGATGGTTATGGGGTGTGTCAAGAACTCCGCAAAGAATCTGACATTCCCATTATC
ATGCTAACTGCACTGGGAGATGTTGCTGACCGCATTACAGGGCTAGAATTAGGCGCGGATGACTATGTGGTCAAACCGTT
TTCTCCCAAGGAGTTAGAAGCCCGTATCCGTTCGGTATTAAGACGAGTGGATAAAGAGGGAATGTCAGGGATTCCCAGTT
CTGGCGTAATTCAGGTGGGTTCAATTAAAATTGATACCAACCGCCGTCAAGTGTATAAAGGAGACGAACGTATTCGCCTT
ACGGGAATGGAGTTTAGTTTGCTAGAACTGATGGTGGGTCGGTCTGGGGAAGCCTTTTCTCGGTCTGAGATTTTGCAGGA
AGTGTGGGGTTATACCCCTGAACGTCATGTGGATACCCGCGTGGTGGATGTGCATATTTCTCGGTTACGCGCCAAACTGG
AAGATGATCCCAGTAACCCAGAATTAATCTTGACTGCTAGAGGAACGGGTTATATGTTCCAGCGTGTGACTGAGGTTGGG
GAGGAAAAATCTCAATGA

Protein sequence :
MENHKEKILVVDDEASIRRILETRLSMIGYDVVTAADGEEAIATFNENHPDLVVLDVMMPKLDGYGVCQELRKESDIPII
MLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVDKEGMSGIPSSGVIQVGSIKIDTNRRQVYKGDERIRL
TGMEFSLLELMVGRSGEAFSRSEILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPELILTARGTGYMFQRVTEVG
EEKSQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-48 48
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-48 48
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-48 48
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-48 48
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-48 48
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-48 48
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-48 48
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-48 48
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-48 48
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-47 48
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-38 45
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-43 45
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-42 45
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-43 44
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 3e-39 43
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-36 42
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-36 41
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-36 41
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-36 41
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-36 41
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-36 41
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-36 41
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-36 41
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-36 41
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 4e-38 41
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 6e-26 41
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-33 41
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-28 41
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-41 41
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 9e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-39 43
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator VFG1389 Protein 8e-34 43
PCC7418_3128 YP_007169461.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-31 41