Gene Information

Name : Deipe_1602 (Deipe_1602)
Accession : YP_007180908.1
Strain : Deinococcus peraridilitoris DSM 19664
Genome accession: NC_019793
Putative virulence/resistance : Virulence
Product : CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1581715 - 1582392 bp
Length : 678 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGGAACGCAAGCCGCTTGTACTGGTCATCGAAGACGAAAAAGACATCGCGCGCTTTATTGAACTCGAACTGGCGGCCGA
AGGGTACGCCACAGAAGTCGCGTTCGACGGGGTCACCGGCCTCTCCAAATTCCGTGAAGTCTCGCCTGACCTGGTCATCC
TCGATTTGATGCTGCCGGTGCTCGACGGCCTGGAGGTCGCGCGCCGTATCCGCAAGACCAGCAACACGCCCATCATCATT
CTGACCGCCAAAGACAACATTCAGGACAAAGTCGAAGGCCTGGACTCGGGCGCTGACGACTACCTCGTCAAGCCGTTCTC
GATCGAAGAGCTGCTCGCCCGTGTACGCGCGCACCTTCGGCGCGTCAACCCGGCTGTCACCGGTGAAGTGCGCGTGGCCG
ACCTCGTCATGAACCTCGATGGACGTGAGATCTTTCGTGGTGGACGCCGGGTGGAACTCTCCGCCAAGGAATTCGAACTG
CTCGAACTGCTGGCGCGCAATCCCGGCAAGGTTTTTTCACGCTTTGAAATCGAAGAGAAAGTCTGGCCCGAGTACACCGG
CGGCAGCAACGTCGTGGACGTGTACATCGGGTACCTGCGCCGCAAGCTTGAGGAAGGCGGCGAACGCCGCTTGATTCACA
CCGTACGCGGCGTGGGCTACGTCCTGCGCGAAGAGTAA

Protein sequence :
MERKPLVLVIEDEKDIARFIELELAAEGYATEVAFDGVTGLSKFREVSPDLVILDLMLPVLDGLEVARRIRKTSNTPIII
LTAKDNIQDKVEGLDSGADDYLVKPFSIEELLARVRAHLRRVNPAVTGEVRVADLVMNLDGREIFRGGRRVELSAKEFEL
LELLARNPGKVFSRFEIEEKVWPEYTGGSNVVDVYIGYLRRKLEEGGERRLIHTVRGVGYVLREE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-27 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-27 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator HE999704.1.gene1528. Protein 9e-33 48
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator BAC0125 Protein 8e-35 47
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_007622.3794948.p0 Protein 3e-33 46
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_003923.1003417.p0 Protein 3e-33 46
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator AE015929.1.gene1106. Protein 7e-29 46
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_013450.8614146.p0 Protein 3e-33 46
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002951.3238224.p0 Protein 3e-33 46
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_007793.3914065.p0 Protein 3e-33 46
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002758.1121390.p0 Protein 3e-33 46
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_010079.5776364.p0 Protein 3e-33 46
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002952.2859858.p0 Protein 3e-33 46
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_012469.1.7685629. Protein 2e-27 45
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator BAC0197 Protein 6e-30 45
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator BAC0083 Protein 1e-30 43
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator BAC0308 Protein 3e-32 43
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator BAC0347 Protein 4e-26 42
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator BAC0111 Protein 4e-29 42
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator BAC0638 Protein 7e-23 42
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_003923.1003749.p0 Protein 1e-25 41
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator HE999704.1.gene2815. Protein 1e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator VFG1390 Protein 5e-37 50
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator VFG1389 Protein 4e-26 46
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator VFG0596 Protein 5e-28 44
Deipe_1602 YP_007180908.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator VFG1386 Protein 9e-29 42