Gene Information

Name : Deipe_1997 (Deipe_1997)
Accession : YP_007181260.1
Strain : Deinococcus peraridilitoris DSM 19664
Genome accession: NC_019793
Putative virulence/resistance : Virulence
Product : CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1996710 - 1997378 bp
Length : 669 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGGAACAACGTATTTTGTTGATCGAGGACAACCCGGATATCACCCGCGTTGTCTCTTATGAACTCGAACAATCCGGTTA
CCGGGTACTGACGGCGCCGGACGGCGTCAGCGGACTGACCAGCGCACGTGAAAACAACCCCGACCTGGTGATTCTCGATT
TGGGCCTGCCCGACTTCGACGGAGCGGAAATTGCCCGGCGTCTGCGCAAGACCAGCGCAGTGCCGATCATCATCCTGACC
GCCATGGACGCCGTGGACCGTAAAGTGAATCTGCTGGAGGCCGGCGCGGACGACTACATTACCAAGCCCTTTCATCCCGA
AGAGCTGGTGGCCCGCGTCAAGGTGCAGCTGCGTCATCAGCAGCACGGCGAGATCATCAGCATCGGTGCGCTGGAGATTC
ATCCGCAAAAGCGGCTGTGCCACTACAACGGTCACGAAGTGCGACTGTCGCCCAAGGAGTTCGACCTGCTGACCTTCCTG
GCGCGTCAGCCGGGGCGGGTCTACAGTCGCGACGAGATCGAGCGCGAGGTCTGGAACGGCGAACTGCCCTCCAACAGCAA
CGTGGTGGACGTGCACATGGCCAACATGCGCGCCAAACTGCGAGACCTCGACGGCTACGGCATCATCCGCACCGTCCGTG
GCATCGGCTACGCGTTGAAAACACCCTGA

Protein sequence :
MEQRILLIEDNPDITRVVSYELEQSGYRVLTAPDGVSGLTSARENNPDLVILDLGLPDFDGAEIARRLRKTSAVPIIILT
AMDAVDRKVNLLEAGADDYITKPFHPEELVARVKVQLRHQQHGEIISIGALEIHPQKRLCHYNGHEVRLSPKEFDLLTFL
ARQPGRVYSRDEIEREVWNGELPSNSNVVDVHMANMRAKLRDLDGYGIIRTVRGIGYALKTP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-31 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002952.2859905.p0 Protein 1e-35 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_009641.5332272.p0 Protein 1e-35 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_013450.8614146.p0 Protein 9e-34 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_013450.8614421.p0 Protein 1e-35 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002951.3238224.p0 Protein 9e-34 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_007793.3914279.p0 Protein 1e-35 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_007793.3914065.p0 Protein 9e-34 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002758.1121390.p0 Protein 9e-34 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002745.1124361.p0 Protein 1e-35 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_010079.5776364.p0 Protein 9e-34 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_009782.5559369.p0 Protein 1e-35 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002952.2859858.p0 Protein 9e-34 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002951.3237708.p0 Protein 1e-35 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_007622.3794948.p0 Protein 9e-34 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_003923.1003749.p0 Protein 1e-35 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002758.1121668.p0 Protein 1e-35 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_007622.3794472.p0 Protein 1e-35 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_003923.1003417.p0 Protein 9e-34 41
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator HE999704.1.gene2815. Protein 1e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator VFG0596 Protein 1e-31 42
Deipe_1997 YP_007181260.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator VFG1389 Protein 4e-31 42