Gene Information

Name : B938_01330 (B938_01330)
Accession : YP_007184976.1
Strain : Bacillus amyloliquefaciens AS43.3
Genome accession: NC_019842
Putative virulence/resistance : Resistance
Product : Stress response protein SCP2
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 279849 - 280445 bp
Length : 597 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCGATCTCTTTACAAAAAGGACAGCGGATTGATTTAACAAAAGGAAAAGCCGGTCTGTCAAAACTGCTGGTCGGACT
CGGCTGGGACCCTGTATCATCCGGGGGCTTTTTCGGAAAGCTGTTCGGCGGAGGCGGTGCCAATATCGACTGTGACGCTT
CCGTACTGATGCTTGAAAATGATAAAATGACAGACAGTAAAAACGTCATCTATTTCGGCAATCTGAAAAGCCGATGCGGC
GGTGTCGTACACACGGGTGACAACCTGACGGGAGAAGGCGACGGCGATGATGAACAAATTCTCATCGATTTGGCGAAAGT
CCCCGCTCAGATTAATAAACTTGTGTTTGTCGTCAATATTTACGACTGCGTCAGACGAAAACAGGACTTCGGCATGATTC
AAAACGCGTTCATCCGCGTCGTTGATCAGGCTAACCGCGAAGAACTGGTGACTTACAATTTAAGAGATAACTATTCAGGC
AGAACGAGCCTGATCGCGGCTGAAATCTACCGCCAGGACGGCGAGTGGAAATTCGCCGCAGTAGGAGAAGGCACAAACGA
TACAAAAATCGGCGATATCGTTAACCGATACGCCTAA

Protein sequence :
MAISLQKGQRIDLTKGKAGLSKLLVGLGWDPVSSGGFFGKLFGGGGANIDCDASVLMLENDKMTDSKNVIYFGNLKSRCG
GVVHTGDNLTGEGDGDDEQILIDLAKVPAQINKLVFVVNIYDCVRRKQDFGMIQNAFIRVVDQANREELVTYNLRDNYSG
RTSLIAAEIYRQDGEWKFAAVGEGTNDTKIGDIVNRYA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-33 46
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-33 46
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-33 46
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-37 46
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-28 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-28 44
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-28 43
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-34 43
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-34 43
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-34 43
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B938_01330 YP_007184976.1 Stress response protein SCP2 BAC0390 Protein 2e-34 45
B938_01330 YP_007184976.1 Stress response protein SCP2 BAC0389 Protein 1e-33 44
B938_01330 YP_007184976.1 Stress response protein SCP2 BAC0392 Protein 4e-28 43