Gene Information

Name : Theco_2689 (Theco_2689)
Accession : YP_007213777.1
Strain : Thermobacillus composti KWC4
Genome accession: NC_019897
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2797802 - 2798512 bp
Length : 711 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
GTGCGCAGACGCATTCTCGTCGTGGATGATGAACCGTCCATTGCCGCGCTGCTGGAATACAATCTGCAGCTTGCCGGTTA
CGACGTCAGATGCGTGTCCGACGGCGAAGCCGTTTTCGACGCGCTCGGACCTTTCCGGCCGGATCTGATCGTGCTCGACC
GGATGCTTCCCCGGATGGACGGCTTGGAAGTATGCCGCCGGCTGCGGCGGGAGAAGAACGAAGTGCCCGTCATCATGCTG
ACCGCGCTGCACGACGTGTCCGACCGGATCGCCGGACTTGCGGGCGGAGCGGACGATTATATGACGAAGCCGTTCAGCCC
GCAGGAGCTCATCGCGCGCATCGGCGCGATCTTCCGCAGAACCGGGGAGCCGGCCCGGACGGAAAGCGAAGGCGTGCACC
GGATCGGCCGGCTGACCGTGCGCGCCGACGCGCGCGAAGTCGAACTGGACGGACGTCCGGTCGAGCTGACGCCGAAGGAA
TTCGACCTGCTGCTCTTCATGTGCCGCCGCCGCGGCAAAGTGCTGAGCCGCCGGCAGATCCTGCACGGTGTCTGGGACTG
CCCGATCGTCGGCGACACCCGGATCGTCGACGTCCACATCAGCCATCTGCGCGACAAGATCGAGAAGAACGCCCGCTCGC
CGGAGTATATCATGACCGTGCGCAGCGTAGGCTACAAGCTGACCGGTCCGCCGGATGAGCCGACGGCGTGA

Protein sequence :
MRRRILVVDDEPSIAALLEYNLQLAGYDVRCVSDGEAVFDALGPFRPDLIVLDRMLPRMDGLEVCRRLRREKNEVPVIML
TALHDVSDRIAGLAGGADDYMTKPFSPQELIARIGAIFRRTGEPARTESEGVHRIGRLTVRADAREVELDGRPVELTPKE
FDLLLFMCRRRGKVLSRRQILHGVWDCPIVGDTRIVDVHISHLRDKIEKNARSPEYIMTVRSVGYKLTGPPDEPTA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-35 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene2815. Protein 5e-56 53
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 3e-54 51
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 1e-54 50
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 1e-54 50
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 1e-54 50
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 1e-54 50
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 1e-54 50
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 1e-54 50
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 2e-54 50
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 1e-54 50
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 1e-54 50
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE016830.1.gene1681. Protein 9e-51 48
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 2e-40 44
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 4e-29 42
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7686381. Protein 3e-44 42
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 2e-29 42
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 5e-40 42
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 1e-35 41
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 1e-35 41
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 1e-35 41
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 1e-35 41
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 1e-35 41
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 1e-35 41
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 1e-35 41
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 5e-38 43
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 4e-34 43
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1563 Protein 8e-36 42
Theco_2689 YP_007213777.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1702 Protein 1e-35 42