Gene Information

Name : B479_27259 (B479_27259)
Accession : YP_007232244.1
Strain :
Genome accession: NC_019906
Putative virulence/resistance : Resistance
Product : quaternary ammonium compound-resistance protein QacE
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 74513 - 74845 bp
Length : 333 bp
Strand : +
Note : COG2076 Membrane transporters of cations and cationic drugs

DNA sequence :
GTGAAGAACTGGCTCTTTCTGGCTATTGCAATATTTGGTGAGGTCGTCGCAACTTCCGCACTGAAGTCCAGCCATGGATT
CACCAAGTTAGTTCCTTCTGTTGTAGTTGTGGCTGGCTACGGGCTTGCGTTCTATTTCCTCTCTCTCGCACTCAAGTCCA
TCCCGGTCGGCATTGCTTATGCTGTTTGGGCTGGCCTCGGCATCGTACTTGTGGCAGCTATCGCTTGGATCTTCCATGGC
CAGAAACTAGACTTGTGGGCGTTCGTTGGCATGGGACTTATCGTTAGTGGCGTCGCCGTTCTAAATCTGCTATCCAAGGT
CAGCGCACATTGA

Protein sequence :
MKNWLFLAIAIFGEVVATSALKSSHGFTKLVPSVVVVAGYGLAFYFLSLALKSIPVGIAYAVWAGLGIVLVAAIAWIFHG
QKLDLWAFVGMGLIVSGVAVLNLLSKVSAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-32 76
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 9e-32 76
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-32 76
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 9e-32 76
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 9e-32 76
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-32 76
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 9e-32 76
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-32 76
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-31 76
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 9e-32 76
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-31 76
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 9e-32 76
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 9e-32 76
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-31 76
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 9e-32 76
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-32 76
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-31 76
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-32 76
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-31 76
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 1e-12 43
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 1e-13 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE BAC0324 Protein 1e-42 94
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE BAC0322 Protein 5e-37 80
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE BAC0323 Protein 4e-32 76
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE BAC0377 Protein 1e-19 57
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE BAC0002 Protein 6e-26 57
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE NC_010410.6003348.p0 Protein 6e-26 57
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE CP004022.1.gene1549. Protein 7e-21 54
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE CP001138.1.gene1489. Protein 2e-22 54
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE NC_002695.1.913273.p Protein 8e-19 49
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE BAC0150 Protein 6e-19 48
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE BAC0192 Protein 1e-14 47
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE BAC0139 Protein 4e-14 46
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE BAC0140 Protein 6e-13 44
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE BAC0329 Protein 1e-13 44
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE BAC0249 Protein 2e-09 43
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE AE000516.2.gene3301. Protein 2e-09 43
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE BAC0326 Protein 4e-13 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE VFG1586 Protein 5e-13 43
B479_27259 YP_007232244.1 quaternary ammonium compound-resistance protein QacE VFG1587 Protein 4e-14 42