Gene Information

Name : Psest_1185 (Psest_1185)
Accession : YP_007239379.1
Strain : Pseudomonas stutzeri RCH2
Genome accession: NC_019936
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1287273 - 1287947 bp
Length : 675 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; TIGRFAM: heavy metal response regulator

DNA sequence :
ATGCGAATTCTGGTGGTGGAGGACGAAGCCAAGACGGCTGACTACCTCAAGCGCGGGCTGGAGGAATCTGGCTATCGCGT
CGAGGTGGCGCGCAACGGCGTCGATGGCAAATACCTGATTGAGGAGGAGACCTTCGACCTGGTGATCCTCGACGTCATGC
TGCCGGGGCTCGACGGCTGGGAGCTGGTACAGGTGGTGCGCAGGCGCTCGGCGCATACGCCGGTGCTGTTCCTCACCGCG
CGCGATGCGGTGGAAGACCGTGTGCGTGGGCTGGAGCTGGGCGCCGACGACTATCTGGTCAAGCCGTTCTCCTACGCCGA
GCTGCTGGCGCGGGTACGCACCCTGCTGCGGCGCGGACCGCCGCGGGAAGTCGAGCGCTTTCAGGTTGCTGATCTTGAGC
TGGACCTGTTGCGCCGTCGCGTCAGTCGCCAGGGCGAACGCATCAGCCTGACCAACAAGGAGTTTGCCTTGCTGCACCTG
TTGCTGCTGCGCCAAGGCGAGGTGCTCTCGCGTGCGCAGATCGCCTCGCAGGTCTGGCAGATGAACTTCGACAGCGACAC
CAATGTGGTCGACGTGGCGATCCGCCGCCTGCGCGCCAAGGTCGACGACCCCTATCCGCTCAAGCTTATCCACACCGTGC
GCGGTATGGGCTATGTGCTGGAAGCCGCCACGTGA

Protein sequence :
MRILVVEDEAKTADYLKRGLEESGYRVEVARNGVDGKYLIEEETFDLVILDVMLPGLDGWELVQVVRRRSAHTPVLFLTA
RDAVEDRVRGLELGADDYLVKPFSYAELLARVRTLLRRGPPREVERFQVADLELDLLRRRVSRQGERISLTNKEFALLHL
LLLRQGEVLSRAQIASQVWQMNFDSDTNVVDVAIRRLRAKVDDPYPLKLIHTVRGMGYVLEAAT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-58 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-57 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 5e-70 66
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 2e-67 65
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 2e-67 64
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 1e-59 63
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 2e-65 59
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 2e-61 59
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 9e-58 55
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-35 45
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 5e-35 45
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 5e-35 45
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 9e-35 45
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 5e-35 45
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 5e-35 45
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 5e-35 45
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-35 45
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 5e-35 45
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 5e-35 45
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-27 44
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 9e-36 43
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 9e-36 43
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 9e-36 43
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 9e-36 43
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 9e-36 43
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 9e-36 43
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 9e-36 43
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 9e-36 43
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 4e-27 42
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 6e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 3e-58 58
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 2e-41 46
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 4e-34 46
Psest_1185 YP_007239379.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 5e-36 43