Gene Information

Name : resD (TepiRe1_1690)
Accession : YP_007272450.1
Strain : Tepidanaerobacter acetatoxydans Re1
Genome accession: NC_019954
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1606140 - 1606832 bp
Length : 693 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 10972836, 15028686, 15375128, 16825793,16885456, 17322317; Product type r : regulator

DNA sequence :
GTGCAAGGAAACGCAAGAATACTTGTAGTTGATGATGAAAAACGTATTGTAGATTTGGTGAGATTGTATTTGGAAAGGGA
AGGATTTATTGTCGATGAGGCTTTTGAAGGCCAACAGGCTCTAGACATGATATCAAGTGTATCCTATGATTTGATTATTT
TGGATCTGATGCTTCCGGTTATTGACGGTTGGACTGTTTGTAAAAAAATCAGAGAAAAATATGATACGCCTGTGATAATG
CTGACAGCTCGAGGCGAAGAATTTGACAAGGTTTTGGGGTTTGAATTAGGAGCAGATGATTATGTAGTAAAACCTTTCAG
TCCCAGAGAACTTACGGCTAGAGTTAAAGCATTATTGAGGCGTATGGCATCTAAGCAAGATTATGAAGCTGAAGCCTTGA
TTTTTCCGGAATTGTTAATTGATCCTGCAGCTAGAGTTGTTAAAGTTGATGGAAAAGAAGTTGCACTTACACCTAAGGAA
TTTGACCTATTATATTTTTTAGCTAAAAATAAAGGGAAAGCATTTAATAGAGAAAAGCTGCTAAAAGAAGTTTGGGGTTA
TGATTTTTACGGTAGTTTGCGAACTGTGGACACGCACATAAAACAACTTAGGGAAAAACTTGGCCGCAGCAAAGCTGCCT
CATATATAAATACTGTTTGGGGTATTGGCTATAAATTTGAGGTGGAAAAGTGA

Protein sequence :
MQGNARILVVDDEKRIVDLVRLYLEREGFIVDEAFEGQQALDMISSVSYDLIILDLMLPVIDGWTVCKKIREKYDTPVIM
LTARGEEFDKVLGFELGADDYVVKPFSPRELTARVKALLRRMASKQDYEAEALIFPELLIDPAARVVKVDGKEVALTPKE
FDLLYFLAKNKGKAFNREKLLKEVWGYDFYGSLRTVDTHIKQLREKLGRSKAASYINTVWGIGYKFEVEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-40 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-40 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_007272450.1 two-component response regulator NC_012469.1.7685629. Protein 4e-49 49
resD YP_007272450.1 two-component response regulator AM180355.1.gene1830. Protein 8e-46 48
resD YP_007272450.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-45 48
resD YP_007272450.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-45 48
resD YP_007272450.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-45 48
resD YP_007272450.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-45 48
resD YP_007272450.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-45 48
resD YP_007272450.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-45 48
resD YP_007272450.1 two-component response regulator NC_003923.1003749.p0 Protein 1e-45 48
resD YP_007272450.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-45 48
resD YP_007272450.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-45 47
resD YP_007272450.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-45 47
resD YP_007272450.1 two-component response regulator HE999704.1.gene2815. Protein 3e-47 47
resD YP_007272450.1 two-component response regulator AF130997.1.orf0.gene Protein 3e-41 46
resD YP_007272450.1 two-component response regulator DQ212986.1.gene4.p01 Protein 2e-43 46
resD YP_007272450.1 two-component response regulator NC_012469.1.7686381. Protein 2e-45 46
resD YP_007272450.1 two-component response regulator NC_013450.8614146.p0 Protein 6e-43 45
resD YP_007272450.1 two-component response regulator NC_002951.3238224.p0 Protein 6e-43 45
resD YP_007272450.1 two-component response regulator NC_007793.3914065.p0 Protein 6e-43 45
resD YP_007272450.1 two-component response regulator NC_002758.1121390.p0 Protein 6e-43 45
resD YP_007272450.1 two-component response regulator NC_010079.5776364.p0 Protein 6e-43 45
resD YP_007272450.1 two-component response regulator NC_002952.2859858.p0 Protein 6e-43 45
resD YP_007272450.1 two-component response regulator NC_007622.3794948.p0 Protein 6e-43 45
resD YP_007272450.1 two-component response regulator NC_003923.1003417.p0 Protein 6e-43 45
resD YP_007272450.1 two-component response regulator AF155139.2.orf0.gene Protein 1e-46 45
resD YP_007272450.1 two-component response regulator FJ349556.1.orf0.gene Protein 3e-46 45
resD YP_007272450.1 two-component response regulator AE015929.1.gene1106. Protein 2e-37 44
resD YP_007272450.1 two-component response regulator BAC0125 Protein 1e-38 44
resD YP_007272450.1 two-component response regulator AE016830.1.gene1681. Protein 5e-44 44
resD YP_007272450.1 two-component response regulator AF162694.1.orf4.gene Protein 5e-36 43
resD YP_007272450.1 two-component response regulator NC_005054.2598277.p0 Protein 3e-44 43
resD YP_007272450.1 two-component response regulator NC_011595.7057856.p0 Protein 6e-37 43
resD YP_007272450.1 two-component response regulator NC_010410.6002989.p0 Protein 6e-37 43
resD YP_007272450.1 two-component response regulator NC_010400.5986590.p0 Protein 4e-36 43
resD YP_007272450.1 two-component response regulator NC_014475.1.orf0.gen Protein 3e-44 43
resD YP_007272450.1 two-component response regulator BAC0197 Protein 1e-35 43
resD YP_007272450.1 two-component response regulator CP001918.1.gene3444. Protein 8e-36 43
resD YP_007272450.1 two-component response regulator CP000647.1.gene2531. Protein 4e-36 43
resD YP_007272450.1 two-component response regulator CP001918.1.gene5135. Protein 2e-26 43
resD YP_007272450.1 two-component response regulator EU250284.1.orf4.gene Protein 2e-36 42
resD YP_007272450.1 two-component response regulator CP000034.1.gene3834. Protein 9e-32 42
resD YP_007272450.1 two-component response regulator CP001138.1.gene4273. Protein 7e-31 42
resD YP_007272450.1 two-component response regulator NC_002695.1.915041.p Protein 9e-32 42
resD YP_007272450.1 two-component response regulator CP004022.1.gene3215. Protein 8e-36 42
resD YP_007272450.1 two-component response regulator CP001138.1.gene2239. Protein 3e-36 42
resD YP_007272450.1 two-component response regulator BAC0039 Protein 1e-36 42
resD YP_007272450.1 two-component response regulator BAC0596 Protein 3e-36 42
resD YP_007272450.1 two-component response regulator CP000034.1.gene2186. Protein 1e-36 42
resD YP_007272450.1 two-component response regulator NC_002695.1.916589.p Protein 8e-37 42
resD YP_007272450.1 two-component response regulator AE000516.2.gene3505. Protein 1e-37 42
resD YP_007272450.1 two-component response regulator CP000675.2.gene1535. Protein 4e-38 41
resD YP_007272450.1 two-component response regulator CP000647.1.gene4257. Protein 1e-30 41
resD YP_007272450.1 two-component response regulator BAC0533 Protein 1e-30 41
resD YP_007272450.1 two-component response regulator CP004022.1.gene1676. Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_007272450.1 two-component response regulator VFG1389 Protein 7e-33 43
resD YP_007272450.1 two-component response regulator VFG1702 Protein 8e-41 42
resD YP_007272450.1 two-component response regulator VFG1563 Protein 2e-40 42