
|
Name : VPBB_1533 (VPBB_1533) Accession : YP_007275186.1 Strain : Genome accession: NC_019955 Putative virulence/resistance : Virulence Product : Type III secretion inner membrane protein (YscS, flagellar export protein-like protein) Function : - COG functional category : - COG ID : - EC number : - Position : 1736905 - 1737171 bp Length : 267 bp Strand : + Note : Equivalent to RIMD VP1673 translocation protein in type III secretion DNA sequence : ATGAATCCTGCAGAAATCATCCATTTCACAACGCAAGCACTCACTTTGGTTCTGTTCTTGTCGCTACCACCAATTTTGGT CGCAGCATTAGTCGGCACCTTAGTGTCGCTGATCCAAGCACTGACTCAGGTACAAGAGCAAACGTTAGGGTTTGTCGTGA AGCTCATTGCCGTGATCATCACCCTGTTCATCACAACGCAGTGGCTAGGTGCAGAGCTGCACGCTTTTGCCTCACTCGCT CTGGATAAAATTCCACAAATACGATGA Protein sequence : MNPAEIIHFTTQALTLVLFLSLPPILVAALVGTLVSLIQALTQVQEQTLGFVVKLIAVIITLFITTQWLGAELHAFASLA LDKIPQIR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| lscS | AAO18039.1 | LscS | Virulence | TTSS locus | Protein | 2e-24 | 69 |
| hrcS | AAB06006.1 | HrcS | Virulence | Hrp PAI | Protein | 3e-13 | 50 |
| hrcS | AAT96201.1 | HrcS | Virulence | T-PAI | Protein | 1e-10 | 49 |
| hrcS | AAG33885.1 | HrcS | Virulence | Hrp PAI | Protein | 8e-11 | 49 |
| hrcS | ABQ88360.1 | HrcS | Virulence | Hrp PAI | Protein | 6e-08 | 49 |
| hrpO | AAB05076.1 | HrpO | Virulence | Hrp PAI | Protein | 6e-08 | 49 |
| hrcS | NP_791221.1 | type III secretion protein HrcS | Virulence | Hrp PAI | Protein | 1e-10 | 49 |
| hrcS | AAT96147.1 | HrcS | Virulence | T-PAI | Protein | 1e-10 | 49 |
| hrcS | AAT96263.1 | HrcS | Virulence | S-PAI | Protein | 5e-11 | 48 |
| hrcS | AAT96304.1 | HrcS | Virulence | S-PAI | Protein | 5e-11 | 48 |
| hrcS | AAT96344.1 | HrcS | Virulence | S-PAI | Protein | 5e-11 | 48 |
| YPO0271 | YP_002345353.1 | type III secretion apparatus protein | Virulence | Not named | Protein | 3e-08 | 48 |
| spaQ | AAS66866.1 | SpaQ | Not tested | SSR-2 | Protein | 1e-09 | 48 |
| ssaS | YP_216428.1 | secretion system apparatus protein SsaS | Virulence | SPI-2 | Protein | 3e-11 | 47 |
| ssaS | NP_460385.1 | type III secretion system apparatus protein | Virulence | SPI-2 | Protein | 3e-11 | 47 |
| ssaS | CAA68200.1 | secretion system apparatus, SsaS | Virulence | SPI-2 | Protein | 2e-11 | 47 |
| ssaS | NP_456108.1 | putative type III secretion protein | Virulence | SPI-2 | Protein | 3e-11 | 47 |
| ssaS | NP_805091.1 | type III secretion protein | Virulence | SPI-2 | Protein | 3e-11 | 47 |
| hrcS | ABA47280.1 | HrcS | Virulence | S-PAI | Protein | 1e-10 | 47 |
| epaQ | AAZ31292.1 | EpaQ | Virulence | ETT2 | Protein | 7e-11 | 46 |
| ECs3724 | NP_311751.1 | EpaQ | Not tested | LIM | Protein | 1e-10 | 46 |
| escS | AFO66401.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 6e-13 | 43 |
| escS | AFO66341.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 6e-13 | 43 |
| ysaS | AAS66847.1 | YsaS | Not tested | SSR-1 | Protein | 2e-06 | 43 |
| spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | Virulence | SPI-1 | Protein | 6e-09 | 42 |
| spaQ | NP_457283.1 | secretory protein (associated with virulence) | Virulence | SPI-1 | Protein | 6e-09 | 42 |
| spaQ | NP_806492.1 | virulence-associated secretory protein | Virulence | SPI-1 | Protein | 6e-09 | 42 |
| spaQ | NP_461810.1 | needle complex export protein | Virulence | SPI-1 | Protein | 6e-09 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| VPBB_1533 | YP_007275186.1 | Type III secretion inner membrane protein (YscS, flagellar export protein-like protein) | VFG0395 | Protein | 8e-27 | 70 |
| VPBB_1533 | YP_007275186.1 | Type III secretion inner membrane protein (YscS, flagellar export protein-like protein) | VFG0187 | Protein | 2e-18 | 66 |
| VPBB_1533 | YP_007275186.1 | Type III secretion inner membrane protein (YscS, flagellar export protein-like protein) | VFG0043 | Protein | 1e-17 | 56 |
| VPBB_1533 | YP_007275186.1 | Type III secretion inner membrane protein (YscS, flagellar export protein-like protein) | VFG0520 | Protein | 8e-12 | 47 |
| VPBB_1533 | YP_007275186.1 | Type III secretion inner membrane protein (YscS, flagellar export protein-like protein) | VFG1772 | Protein | 3e-11 | 43 |
| VPBB_1533 | YP_007275186.1 | Type III secretion inner membrane protein (YscS, flagellar export protein-like protein) | VFG0550 | Protein | 2e-09 | 42 |
| VPBB_1533 | YP_007275186.1 | Type III secretion inner membrane protein (YscS, flagellar export protein-like protein) | VFG2454 | Protein | 2e-05 | 42 |
| VPBB_1533 | YP_007275186.1 | Type III secretion inner membrane protein (YscS, flagellar export protein-like protein) | VFG1013 | Protein | 2e-09 | 41 |