Gene Information

Name : Thethe_01617 (Thethe_01617)
Accession : YP_007298950.1
Strain : Thermoanaerobacterium thermosaccharolyticum M0795
Genome accession: NC_019970
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1577696 - 1578385 bp
Length : 690 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGAAAATACTAGCAATAGATGACGAAGAAAAGATTTTAGATGTTATAAAAGCATATCTTGAGCGGGAAGGGTACTCTGT
ATTTACTGAGACAAACGGAGCAAATGCCATAAATACATTTAAAAGTCTGAAACCTGATTTAGTGATATTGGATTTAATGC
TTCCAGGATTGTCAGGTGAAGAGATATGCAGTAAGATAAGAGCTATATCAAAAGTACCAATTCTCATGCTGACAGCTAAG
GTAGAGGAAGATGATAAGGTATATGGATTTTCAATTGGTGCGGATGATTATCTTACAAAACCATTTAGCCCAAGAGAGCT
GACAATGAGAGTTAAAGCCATATTGAGGCGCACAAAGGATGATATGGCTTTAAATGATATATTTTCATTTAATGATGGTG
ATCTCGTAATTGATACAAGATCTTACGAGGTTAAGAAAAGTGGAGAGATTGTCAACTTGACTCCCAATGAATACAAGTTG
CTTACGGTGATGGCGCAAAACCCCAATAGAGTATTCACGCGAGGAGAGCTTATAGAAAAAGTTATGGGGTATGACTTTGA
AGGCTTTGATAGGACAATCGATGCGCATATAAAAAACCTTCGCCAAAAAATAGAGGATGACCCCAAAAATCCTGTATATA
TAAAAACTGTGTATGGTGCAGGTTATAAATTTGGTGAAGAAAATGCTTAG

Protein sequence :
MKILAIDDEEKILDVIKAYLEREGYSVFTETNGANAINTFKSLKPDLVILDLMLPGLSGEEICSKIRAISKVPILMLTAK
VEEDDKVYGFSIGADDYLTKPFSPRELTMRVKAILRRTKDDMALNDIFSFNDGDLVIDTRSYEVKKSGEIVNLTPNEYKL
LTVMAQNPNRVFTRGELIEKVMGYDFEGFDRTIDAHIKNLRQKIEDDPKNPVYIKTVYGAGYKFGEENA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-37 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 1e-40 49
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE016830.1.gene1681. Protein 4e-39 46
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7686381. Protein 2e-41 46
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 1e-42 46
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 1e-42 46
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 1e-42 46
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 1e-42 46
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 1e-42 46
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 1e-42 46
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 1e-42 46
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 1e-42 46
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 1e-42 45
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 1e-42 45
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene2815. Protein 3e-42 45
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 4e-40 44
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain DQ212986.1.gene4.p01 Protein 3e-37 43
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_014475.1.orf0.gen Protein 2e-35 42
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_005054.2598277.p0 Protein 2e-35 42
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 9e-25 41
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AM180355.1.gene1830. Protein 3e-34 41
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_011586.7046392.p0 Protein 4e-33 41
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010410.6002907.p0 Protein 4e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1563 Protein 9e-38 41
Thethe_01617 YP_007298950.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1702 Protein 2e-38 41