Gene Information

Name : RTCIAT899_CH05445 (RTCIAT899_CH05445)
Accession : YP_007333043.1
Strain : Rhizobium tropici CIAT 899
Genome accession: NC_020059
Putative virulence/resistance : Virulence
Product : two-component response regulator protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1108072 - 1108743 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGCGCATTCTCATAGTCGAAGACGATATCAACTTGAACCGTCAGCTTGCCGAGGCCTTGAAGGAGGCAGGCTATGTGGT
CGATACGGCCTTTGATGGCGAGGAAGGGCATTTCCTCGGCGATACCGAGCCTTACGATGCGATCATCCTCGATATCGGCT
TGCCTGAAATGGATGGCATCACAGTGCTTGAGAAATGGCGCGGCGCCGGACGCACCGTACCGGTGCTCCTCTTGACTGCC
CGCGACCGCTGGAGCGACAAGGTGGCAGGCATCGACGCCGGCGCCGACGACTACGTCGCCAAGCCTTTCCATGTCGAGGA
AGTGCTCGCCCGCATCCGTGCTCTCATCCGCCGCGCCGCCGGCCATGCTTCTTCGGAAATCGTCTGCGGTCCGGTGCGGC
TCGACACCAAGAGCTCGAAGGCAACTGTCGACGGCAAGCCGCTAAAGCTCACCTCGCACGAATATCGCCTGCTTGCCTAT
CTCATGCATCACAAGGGTGAGGTTGTCTCACGCACCGAGCTGGTCGAGCACATGTATGATCAGGATTTCGACCGGGATTC
CAATACGATCGAGGTATTTGTCGGGCGCCTGCGCAAGAAGATGGGTGTCGACCTGATCGAAACGGTCCGCGGCCTTGGTT
ACCGAATCCAAGCTCCGACCAATGCGAATTAA

Protein sequence :
MRILIVEDDINLNRQLAEALKEAGYVVDTAFDGEEGHFLGDTEPYDAIILDIGLPEMDGITVLEKWRGAGRTVPVLLLTA
RDRWSDKVAGIDAGADDYVAKPFHVEEVLARIRALIRRAAGHASSEIVCGPVRLDTKSSKATVDGKPLKLTSHEYRLLAY
LMHHKGEVVSRTELVEHMYDQDFDRDSNTIEVFVGRLRKKMGVDLIETVRGLGYRIQAPTNAN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-27 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein CP000647.1.gene1136. Protein 5e-37 46
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein NC_002516.2.879194.p Protein 1e-39 46
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein BAC0530 Protein 4e-37 46
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein CP004022.1.gene1005. Protein 9e-41 45
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein CP001918.1.gene2526. Protein 4e-35 44
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein CP001138.1.gene1939. Protein 2e-36 44
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein BAC0487 Protein 2e-28 44
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein BAC0347 Protein 9e-28 43
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein BAC0111 Protein 1e-30 43
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein CP000034.1.gene2022. Protein 9e-36 43
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein NC_002695.1.913289.p Protein 4e-35 43
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein BAC0308 Protein 6e-27 42
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein BAC0197 Protein 3e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein VFG0475 Protein 2e-36 44
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein VFG0596 Protein 2e-27 43
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein VFG0473 Protein 8e-28 42
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein VFG1390 Protein 3e-26 41
RTCIAT899_CH05445 YP_007333043.1 two-component response regulator protein VFG1389 Protein 2e-27 41