Gene Information

Name : RTCIAT899_CH13600 (RTCIAT899_CH13600)
Accession : YP_007334644.1
Strain : Rhizobium tropici CIAT 899
Genome accession: NC_020059
Putative virulence/resistance : Resistance
Product : small multidrug resistance (SMR) family efflux pump
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2735858 - 2736199 bp
Length : 342 bp
Strand : -
Note : -

DNA sequence :
ATGGCGAACGCATCGATCTATGCAATGCTGTTGGTTGCGATCGTGCTGGAAGTGATCGGCACGACGGCGTTGCAGATGTC
TCAGCAGTTCACCCGCCTCGGCCCGACAGTGGTTTTGGTGATCTGCTATACGGCCGCCTTCTATTGTCTTTCGGTGACAT
TGCGGGTCATCCCGGTGGGCATCGCCTATGCTATCTGGAGCGCGCTCGGCATCGTGCTGATTTCGATGGTGGGGGTCGTG
CTTTTCCGCCAGAAACTCGACCTTGCTGCCGTCATCGGTCTGGGTCTGATCATTGCCGGCGTGCTCGTCGTCAATCTCTT
TTCAAAATCCGTGTCGCACTGA

Protein sequence :
MANASIYAMLLVAIVLEVIGTTALQMSQQFTRLGPTVVLVICYTAAFYCLSVTLRVIPVGIAYAIWSALGIVLISMVGVV
LFRQKLDLAAVIGLGLIIAGVLVVNLFSKSVSH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 5e-18 52
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 5e-18 52
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 5e-18 52
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 5e-18 52
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 5e-18 52
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 5e-18 52
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 5e-18 52
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 5e-18 52
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 5e-18 52
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 5e-18 52
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 5e-18 52
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 5e-18 52
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 7e-18 52
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 5e-18 52
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 5e-18 52
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 5e-18 52
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 7e-18 52
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 5e-18 52
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 5e-18 52
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 5e-18 52
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 7e-18 52
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 5e-18 52
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 5e-18 52
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 5e-18 52
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 7e-18 52
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 5e-18 52
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 5e-18 52
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 7e-18 52
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 5e-18 52
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 5e-18 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump NC_002695.1.913273.p Protein 2e-20 58
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump CP001138.1.gene1489. Protein 2e-24 58
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump BAC0150 Protein 3e-20 57
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump CP004022.1.gene1549. Protein 2e-22 56
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump NC_010410.6003348.p0 Protein 2e-20 55
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump BAC0002 Protein 2e-20 55
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump BAC0324 Protein 1e-20 55
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump BAC0377 Protein 3e-22 54
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump BAC0322 Protein 1e-21 52
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump BAC0323 Protein 2e-18 52
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump BAC0192 Protein 6e-18 47
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump BAC0329 Protein 6e-14 46
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump BAC0140 Protein 2e-12 43
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump BAC0326 Protein 2e-12 42
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump BAC0139 Protein 3e-15 42
RTCIAT899_CH13600 YP_007334644.1 small multidrug resistance (SMR) family efflux pump BAC0327 Protein 2e-13 41