Gene Information

Name : RTCIAT899_PB01745 (RTCIAT899_PB01745)
Accession : YP_007336155.1
Strain :
Genome accession: NC_020061
Putative virulence/resistance : Unknown
Product : putative IS66 family transposase OrfB
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 317824 - 318171 bp
Length : 348 bp
Strand : -
Note : -

DNA sequence :
ATGATCCCGATCAGTTCGAACGTCAGAGTGTGGATTGCCAGCGGTCACTGCGATATGCGCAAGGGTATGCAGGGGTTGGC
TCTCATCGTGCAAGAGGGGCTTAGCCGCAATCCGTTCCAGGGCGACGTTTTTGTTTTCCGCGGGAGAAATGGTCGATTGA
TCAAGGCCCTATGGCATGACGGTGTCGGACTATCGCTTTATGCCAAAAAGTTAGACCGCGGGCGGTTCGTCTGGCCGTCT
GCGGAAGGCGGCGCGATAGCGATATCGCCTGCGCAGCTTTCTTATTTGTTGTCCGGAATTGATTGGCGCCATCCGCAGGA
AACCTCTCGTCCGACGAAGGTCGGATAG

Protein sequence :
MIPISSNVRVWIASGHCDMRKGMQGLALIVQEGLSRNPFQGDVFVFRGRNGRLIKALWHDGVGLSLYAKKLDRGRFVWPS
AEGGAIAISPAQLSYLLSGIDWRHPQETSRPTKVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-25 55
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-28 54
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-28 54
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-26 53
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 8e-26 53
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 7e-28 51
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 7e-28 51
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-25 51
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-25 51
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-25 51
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-25 51
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-25 51
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-25 51
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-25 51
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-25 51
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 7e-19 50
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-27 50
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-25 50
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-24 50
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-24 50
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 6e-25 46
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 6e-25 46
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-25 46
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 5e-24 44
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 5e-24 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RTCIAT899_PB01745 YP_007336155.1 putative IS66 family transposase OrfB VFG1698 Protein 2e-26 53
RTCIAT899_PB01745 YP_007336155.1 putative IS66 family transposase OrfB VFG0792 Protein 9e-26 51
RTCIAT899_PB01745 YP_007336155.1 putative IS66 family transposase OrfB VFG1709 Protein 9e-26 51
RTCIAT899_PB01745 YP_007336155.1 putative IS66 family transposase OrfB VFG1517 Protein 3e-19 50
RTCIAT899_PB01745 YP_007336155.1 putative IS66 family transposase OrfB VFG1665 Protein 6e-28 50
RTCIAT899_PB01745 YP_007336155.1 putative IS66 family transposase OrfB VFG1052 Protein 2e-25 50
RTCIAT899_PB01745 YP_007336155.1 putative IS66 family transposase OrfB VFG1737 Protein 2e-25 46