Gene Information

Name : RTCIAT899_PB02110 (RTCIAT899_PB02110)
Accession : YP_007336216.1
Strain :
Genome accession: NC_020061
Putative virulence/resistance : Unknown
Product : putative IS66 family transposase, OrfB
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 391514 - 391861 bp
Length : 348 bp
Strand : -
Note : -

DNA sequence :
ATGATCCCGATCAGTTCGAACGTCAGAGTGTGGATTGCCAGCGGTCACTGCGATATGCGCAAGGGTATGCAGGGGTTGGC
TCTCATCGTGCAAGAGGGGCTTGGCCGCAATCCGTTCCAGGGCGACGTTTTTGTTTTCCGCGGGAGAAATGGTCGATTGA
TCAAGGCCCTATGGCATGACGGTGTCGGACTATCGCTTTATGCCAAACGGCTCGACCGAGGCCACTTTATTTGGCCGGCG
ACAGTGGACGGAGCCATTGCCCTTACAGCCGGGCAGATGTCCTACCTTCTTGAGGGAATAGACTGGCGAAATCCGCAACA
GACATGGCGTCCGACGAGCGCCGGATAG

Protein sequence :
MIPISSNVRVWIASGHCDMRKGMQGLALIVQEGLGRNPFQGDVFVFRGRNGRLIKALWHDGVGLSLYAKRLDRGHFIWPA
TVDGAIALTAGQMSYLLEGIDWRNPQQTWRPTSAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-24 54
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 6e-27 53
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 6e-27 53
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-25 52
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-25 52
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 7e-27 51
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 7e-27 51
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-25 51
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-25 51
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-25 51
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-25 51
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 5e-25 51
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 5e-25 51
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 5e-25 51
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-25 51
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-19 50
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-26 50
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-24 50
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-24 50
unnamed AAL08461.1 unknown Not tested SRL Protein 8e-25 49
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-25 48
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-25 48
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-25 48
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 5e-24 46
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 5e-24 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RTCIAT899_PB02110 YP_007336216.1 putative IS66 family transposase, OrfB VFG1698 Protein 9e-26 52
RTCIAT899_PB02110 YP_007336216.1 putative IS66 family transposase, OrfB VFG1709 Protein 1e-25 51
RTCIAT899_PB02110 YP_007336216.1 putative IS66 family transposase, OrfB VFG0792 Protein 1e-25 51
RTCIAT899_PB02110 YP_007336216.1 putative IS66 family transposase, OrfB VFG1517 Protein 9e-20 50
RTCIAT899_PB02110 YP_007336216.1 putative IS66 family transposase, OrfB VFG1665 Protein 7e-27 50
RTCIAT899_PB02110 YP_007336216.1 putative IS66 family transposase, OrfB VFG1052 Protein 3e-25 49
RTCIAT899_PB02110 YP_007336216.1 putative IS66 family transposase, OrfB VFG1737 Protein 1e-25 48