Gene Information

Name : D781_3623 (D781_3623)
Accession : YP_007346012.1
Strain : Serratia marcescens FGI94
Genome accession: NC_020064
Putative virulence/resistance : Virulence
Product : heavy metal response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3828955 - 3829626 bp
Length : 672 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; TIGRFAM: heavy metal response regulator

DNA sequence :
ATGCGCATATTAGTGGTTGAAGACGATACCAGCACCGGCGACTACCTGAAAAAGGGGCTGGGAGAGGCCGGATACGGCGT
TGATCTGGCACGCAACGGCACCGATGGTCTGTTCCGGGCGTTGGAGCATGGCTACGACGCCATCGTGCTGGACGTGATGC
TGCCTGGGATTGATGGCTGGCAGATTATTGAGGTGTTGCGCAAGAAAAGCGACGTGCCGATTCTGTTCCTGACGGCGCGC
GACGGGGTGCAGGACCGGATCCACGGTCTTGAGTTGGGCGCCGACGATTATCTGGTCAAACCGTTTTCCTTTACCGAACT
GGTGCTGCGCCTGCGAACGCTGCTGCGTCGCGGCACGGTGCGTGAGTCCGATCACTACGCGATTGCCGACCTGCACATCG
ATGTGCTGCGGCGCAAAGTAACACGCCAGGAAACGCTGATTCCGCTGACCAATAAAGAGTTTATGCTGCTGCATCTGCTG
GCGCGGCGGGAGGGGGAAGTGCTGTCGCGCACCATGATTGCCTCTCAGGTCTGGGATATGAATTTTGACAGCGACACCAA
CGTGGTGGATGTCGCCATCAAGCGACTACGCGCCAAAATCGACCGGCCGTTTGCGACCAAGCTGATTCATACCGTGCGCG
GTATCGGCTACGTCTGTGAGGCGCGCCCGTGA

Protein sequence :
MRILVVEDDTSTGDYLKKGLGEAGYGVDLARNGTDGLFRALEHGYDAIVLDVMLPGIDGWQIIEVLRKKSDVPILFLTAR
DGVQDRIHGLELGADDYLVKPFSFTELVLRLRTLLRRGTVRESDHYAIADLHIDVLRRKVTRQETLIPLTNKEFMLLHLL
ARREGEVLSRTMIASQVWDMNFDSDTNVVDVAIKRLRAKIDRPFATKLIHTVRGIGYVCEARP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-50 55
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-51 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
D781_3623 YP_007346012.1 heavy metal response regulator BAC0125 Protein 4e-62 66
D781_3623 YP_007346012.1 heavy metal response regulator BAC0197 Protein 2e-59 63
D781_3623 YP_007346012.1 heavy metal response regulator BAC0083 Protein 1e-56 60
D781_3623 YP_007346012.1 heavy metal response regulator BAC0308 Protein 4e-55 60
D781_3623 YP_007346012.1 heavy metal response regulator BAC0638 Protein 2e-49 59
D781_3623 YP_007346012.1 heavy metal response regulator BAC0111 Protein 2e-55 58
D781_3623 YP_007346012.1 heavy metal response regulator BAC0347 Protein 3e-47 54
D781_3623 YP_007346012.1 heavy metal response regulator AE000516.2.gene3505. Protein 7e-31 44
D781_3623 YP_007346012.1 heavy metal response regulator HE999704.1.gene1528. Protein 8e-29 42
D781_3623 YP_007346012.1 heavy metal response regulator NC_002952.2859905.p0 Protein 2e-27 42
D781_3623 YP_007346012.1 heavy metal response regulator HE999704.1.gene2815. Protein 8e-24 42
D781_3623 YP_007346012.1 heavy metal response regulator NC_002951.3237708.p0 Protein 3e-27 42
D781_3623 YP_007346012.1 heavy metal response regulator NC_003923.1003749.p0 Protein 2e-27 42
D781_3623 YP_007346012.1 heavy metal response regulator NC_002758.1121668.p0 Protein 3e-27 42
D781_3623 YP_007346012.1 heavy metal response regulator NC_009641.5332272.p0 Protein 3e-27 42
D781_3623 YP_007346012.1 heavy metal response regulator NC_013450.8614421.p0 Protein 3e-27 42
D781_3623 YP_007346012.1 heavy metal response regulator NC_007793.3914279.p0 Protein 3e-27 42
D781_3623 YP_007346012.1 heavy metal response regulator NC_007622.3794472.p0 Protein 2e-27 42
D781_3623 YP_007346012.1 heavy metal response regulator NC_002745.1124361.p0 Protein 3e-27 42
D781_3623 YP_007346012.1 heavy metal response regulator NC_009782.5559369.p0 Protein 3e-27 42
D781_3623 YP_007346012.1 heavy metal response regulator NC_010079.5776364.p0 Protein 7e-31 41
D781_3623 YP_007346012.1 heavy metal response regulator NC_002952.2859858.p0 Protein 7e-31 41
D781_3623 YP_007346012.1 heavy metal response regulator NC_007622.3794948.p0 Protein 7e-31 41
D781_3623 YP_007346012.1 heavy metal response regulator NC_003923.1003417.p0 Protein 7e-31 41
D781_3623 YP_007346012.1 heavy metal response regulator NC_013450.8614146.p0 Protein 7e-31 41
D781_3623 YP_007346012.1 heavy metal response regulator NC_002951.3238224.p0 Protein 7e-31 41
D781_3623 YP_007346012.1 heavy metal response regulator NC_007793.3914065.p0 Protein 7e-31 41
D781_3623 YP_007346012.1 heavy metal response regulator NC_002758.1121390.p0 Protein 7e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
D781_3623 YP_007346012.1 heavy metal response regulator VFG0596 Protein 3e-51 54
D781_3623 YP_007346012.1 heavy metal response regulator VFG1390 Protein 2e-33 43
D781_3623 YP_007346012.1 heavy metal response regulator VFG1386 Protein 4e-29 42
D781_3623 YP_007346012.1 heavy metal response regulator VFG1389 Protein 7e-29 42