Gene Information

Name : qacE (BCHRO640_584)
Accession : YP_007347555.1
Strain : Candidatus Blochmannia chromaiodes 640
Genome accession: NC_020075
Putative virulence/resistance : Resistance
Product : Quaternary ammonium compound-resistance protein qacE
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 678337 - 678666 bp
Length : 330 bp
Strand : +
Note : -

DNA sequence :
ATGGATTATTTATATTTATTTATTGCTATTCTTTCCGAGGTTATTGCTACTTCTTACTTAAAAGCATCTGAAGGATTTAG
TAAATTATATCCTGCTATTGTAGTAATAATTGGTTATACATTCTCTTTTATGTTGTTATCTCTAGTTTTGCAAACAATAC
CAATGGGTATTGCATATTCCTGTTGGGCTGGACTCGGTATTGTGTTTATTACTGCAGCGGGATATATATTTTATGATCAA
AAATTAGATAGTTTAGCTGTTATTGGTATTGCTTTCATTATTATTGGTGTTGTATTAATTAATATATTTTCCAATACGAT
AAAACACTAA

Protein sequence :
MDYLYLFIAILSEVIATSYLKASEGFSKLYPAIVVIIGYTFSFMLLSLVLQTIPMGIAYSCWAGLGIVFITAAGYIFYDQ
KLDSLAVIGIAFIIIGVVLINIFSNTIKH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 2e-19 59
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 2e-19 59
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 2e-19 59
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 3e-19 59
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 2e-19 59
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 2e-19 59
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 2e-19 59
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 3e-19 59
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 2e-19 59
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 2e-19 59
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-19 59
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 3e-19 59
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 2e-19 59
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 2e-19 59
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-19 59
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 3e-19 59
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 2e-19 59
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 2e-19 59
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-19 59
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 3e-19 59
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 2e-19 59
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 2e-19 59
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-19 59
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-19 59
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 2e-19 59
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 2e-19 59
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 2e-19 59
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-19 59
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 2e-19 59
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 2e-19 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qacE YP_007347555.1 Quaternary ammonium compound-resistance protein qacE BAC0002 Protein 2e-18 61
qacE YP_007347555.1 Quaternary ammonium compound-resistance protein qacE NC_010410.6003348.p0 Protein 2e-18 61
qacE YP_007347555.1 Quaternary ammonium compound-resistance protein qacE CP004022.1.gene1549. Protein 5e-19 61
qacE YP_007347555.1 Quaternary ammonium compound-resistance protein qacE BAC0322 Protein 7e-20 59
qacE YP_007347555.1 Quaternary ammonium compound-resistance protein qacE BAC0323 Protein 8e-20 59
qacE YP_007347555.1 Quaternary ammonium compound-resistance protein qacE BAC0324 Protein 1e-18 54
qacE YP_007347555.1 Quaternary ammonium compound-resistance protein qacE CP001138.1.gene1489. Protein 4e-15 53
qacE YP_007347555.1 Quaternary ammonium compound-resistance protein qacE BAC0329 Protein 8e-17 50
qacE YP_007347555.1 Quaternary ammonium compound-resistance protein qacE NC_002695.1.913273.p Protein 9e-14 50
qacE YP_007347555.1 Quaternary ammonium compound-resistance protein qacE BAC0150 Protein 9e-14 50
qacE YP_007347555.1 Quaternary ammonium compound-resistance protein qacE BAC0377 Protein 6e-18 49
qacE YP_007347555.1 Quaternary ammonium compound-resistance protein qacE BAC0326 Protein 5e-16 46
qacE YP_007347555.1 Quaternary ammonium compound-resistance protein qacE BAC0321 Protein 1e-14 44
qacE YP_007347555.1 Quaternary ammonium compound-resistance protein qacE BAC0325 Protein 3e-15 44