Gene Information

Name : Cst_c11670 (Cst_c11670)
Accession : YP_007372773.1
Strain : Clostridium stercorarium DSM 8532
Genome accession: NC_020134
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1273327 - 1274013 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGAATAATAAAACCCGGATTCTGATTGTGGATGATGATATTAACATATGCCAGCTTTTAAAACTGTATCTTGACAAGGA
AGGTTACGAAAACATTGCCGTACATGACGGAAAACAGGCTCTTGAAGTATTCAGGGAGTTTACGCCCAATCTTGTAATTC
TTGACATAATGCTTCCCGGCATGGATGGATGGCAGGTATGCAGGGAGATACGCAAATTCAGTAATATACCTATAATTATG
CTTTCCGCAAGGGATGAAACTTTCGACAAGGTGCTCGGGCTTGAACTGGGCGCAGACGACTATGTTGCGAAACCTTTTGA
ACCCAAGGAACTTATTGCAAGAATAAAAGCGGTATTAAGAAGATATGACAGGGTGGATAATTCACAGGAACAGCTAATTT
TCCCCGGCCTTGTTGTTAATAAGTCTAATTACACCATCCGTGTTCACGGAAAGGAAATGGAGCTGCCGCCAAAGGAGCTG
GAACTTCTTTATTTCCTTGCGTCCAACCCTAATAAGGTTTTTACAAGGGAGCAGCTGCTGGAAAATGTCTGGGGGTTTGA
CTTTTACGGGGATACCCGTACGGTGGATGTGCATGTGAAACGGCTCAGGGAAAAGCTTGAACCGCCTGATCCCCACTGGC
AGCTGAAAACAGTTTGGGGTGTAGGCTATAAGTTTGAGGTGAAATGA

Protein sequence :
MNNKTRILIVDDDINICQLLKLYLDKEGYENIAVHDGKQALEVFREFTPNLVILDIMLPGMDGWQVCREIRKFSNIPIIM
LSARDETFDKVLGLELGADDYVAKPFEPKELIARIKAVLRRYDRVDNSQEQLIFPGLVVNKSNYTIRVHGKEMELPPKEL
ELLYFLASNPNKVFTREQLLENVWGFDFYGDTRTVDVHVKRLREKLEPPDPHWQLKTVWGVGYKFEVK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-32 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 3e-46 50
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 6e-40 49
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 2e-43 48
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-43 45
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-36 45
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 9e-44 45
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-43 45
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-43 45
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-43 45
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-43 45
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-43 45
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-43 45
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-43 45
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-43 45
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 8e-44 45
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 1e-36 44
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 6e-39 44
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 6e-38 44
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family BAC0039 Protein 8e-39 44
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family BAC0596 Protein 6e-38 44
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 8e-39 44
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 6e-38 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 6e-38 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 6e-38 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 6e-38 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 6e-38 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 6e-38 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 3e-34 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 6e-38 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 6e-38 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 3e-36 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 2e-36 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 2e-36 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-42 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 4e-37 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 5e-38 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 4e-38 42
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 4e-29 42
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 9e-36 41
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 2e-36 41
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 2e-36 41
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 2e-26 41
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 5e-27 41
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 5e-27 41
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 7e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family VFG1702 Protein 6e-33 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family VFG1389 Protein 6e-27 43
Cst_c11670 YP_007372773.1 Two component transcriptional regulator, winged helix family VFG1563 Protein 2e-33 42