Gene Information

Name : Cst_c14420 (Cst_c14420)
Accession : YP_007373042.1
Strain : Clostridium stercorarium DSM 8532
Genome accession: NC_020134
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1562395 - 1563081 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGGCTGAGAAAATACTGATAATCGAAGATGATACAAGGCTGGCCAGGTTTCTTGAGCTGGAACTCAGGCACGAGGGGTA
CGAAGTTGAAATAGCCTACGACGGGCGAAGCGGTCTTGAAAAAGCCTTGAGTAATAATCCCGACCTGGTAATTCTTGATC
TGATGCTTCCTCTTCTAAGCGGGATTGAGGTTTTACGGCGTATCAGGAAAGTGTCGGACATGCCCGTTATCATGCTAACT
GCAAAGGATGACGTATCTGATAAGGTGGTAGGTCTTGACAGCGGGGCGGATGATTATGTCACAAAACCATTTGCGATAGA
AGAACTGCTGGCGAGAATAAGGGTTGCCCTTAAAAGGCGAGACAACTCCGCCAAAAGGGAAAGTGACATTATCAGGGCCG
GGGATCTTGTTCTGAATAAGGCAAAGCACACTGTAATGTATAAAGATGAAGAAATAACGCTTTCCAAAAAGGAATATGAT
CTTCTTGAATACCTTATGGAAAACAGGGGTATTGTCCTAACACGCGAGCAGATTCTGGAAAAGGTATGGGGTTATGATTA
TTTTGGAGATACCAATGTAACCGACGTATACATAAGATATCTCAGAGCAAAAATTGATCAGAAATACAACCTTTCTTACA
TAAAAACGGTGCGTGGAGTGGGGTATATTTTTGAAGACGGAGAATAG

Protein sequence :
MAEKILIIEDDTRLARFLELELRHEGYEVEIAYDGRSGLEKALSNNPDLVILDLMLPLLSGIEVLRRIRKVSDMPVIMLT
AKDDVSDKVVGLDSGADDYVTKPFAIEELLARIRVALKRRDNSAKRESDIIRAGDLVLNKAKHTVMYKDEEITLSKKEYD
LLEYLMENRGIVLTREQILEKVWGYDYFGDTNVTDVYIRYLRAKIDQKYNLSYIKTVRGVGYIFEDGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 5e-44 55
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 5e-44 55
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 5e-44 55
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 5e-44 55
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 5e-44 55
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 5e-44 55
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 5e-44 55
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 5e-44 55
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-45 55
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 1e-39 52
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 5e-36 45
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family BAC0125 Protein 1e-34 44
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family BAC0197 Protein 3e-34 43
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 7e-36 43
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-27 43
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family BAC0347 Protein 3e-29 42
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family BAC0083 Protein 6e-34 42
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family BAC0308 Protein 6e-33 42
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-34 42
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-34 42
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-34 42
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-34 42
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-34 42
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-34 42
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-34 42
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-34 42
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 2e-28 41
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-34 41
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-34 41
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family BAC0638 Protein 1e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family VFG1390 Protein 3e-37 44
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family VFG1389 Protein 2e-37 43
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family VFG0596 Protein 5e-33 42
Cst_c14420 YP_007373042.1 Two component transcriptional regulator, winged helix family VFG0473 Protein 3e-25 41