Gene Information

Name : ST548_p1174 (ST548_p1174)
Accession : YP_007386290.1
Strain :
Genome accession: NC_020180
Putative virulence/resistance : Resistance
Product : Mercuric resistance operon coregulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 118764 - 119129 bp
Length : 366 bp
Strand : +
Note : -

DNA sequence :
ATGAGCGCCTACACAGTGTCCCGGCTGGCCCTTGATGCCGGGGTGAGCGTGCATATCGTGCGCGACTACCTGCTGCGCGG
ATTGCTACGGCCGGTCGCGTACACCACGGGCGGCTACGGCTTGTTCGATGACACCGCGTTGCAACGGCTGCGCTTTGTAC
GGGCTGCCTTCGAAGCGGGTATCGGCCTGGACGCACTGGCGCGGCTGTGCCGGGCGCTGGATGCTGCGGACGGTGACGGT
GCGTCTGCGCAGCTTGCCGTGTTGCGGCAACTCGTCGAGCGTCGGCGCGAGGCCCTGGCCAGCCTCGAAATGCAACTGGC
CGCCATGCCAACCGAACCGGCACAGCACGCGGAGAGTCTGCCATGA

Protein sequence :
MSAYTVSRLALDAGVSVHIVRDYLLRGLLRPVAYTTGGYGLFDDTALQRLRFVRAAFEAGIGLDALARLCRALDAADGDG
ASAQLAVLRQLVERRREALASLEMQLAAMPTEPAQHAESLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merD ACN81004.1 MerD Not tested AbaR5 Protein 2e-36 100
merD CAJ77059.1 Mercury operon coregulator protein Not tested AbaR1 Protein 1e-36 100
merD AGK07020.1 MerD Not tested SGI1 Protein 8e-32 90
merD AGK07078.1 MerD Not tested SGI1 Protein 8e-32 90
merD ABQ57370.1 MerD Not tested SGI1 Protein 2e-31 89
merD AFG30119.1 MerD Not tested PAGI-2 Protein 7e-28 83
merD YP_006098386.1 MerR family transcriptional regulator Not tested Tn2411 Protein 1e-27 83
merD ACF06181.1 mercuric resistance protein Not tested Tn5036-like Protein 7e-28 83
merD AET25396.1 MerD Not tested PAGI-2(C) Protein 7e-28 83

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ST548_p1174 YP_007386290.1 Mercuric resistance operon coregulator BAC0666 Protein 3e-32 91
ST548_p1174 YP_007386290.1 Mercuric resistance operon coregulator BAC0668 Protein 3e-32 90
ST548_p1174 YP_007386290.1 Mercuric resistance operon coregulator BAC0665 Protein 4e-33 90
ST548_p1174 YP_007386290.1 Mercuric resistance operon coregulator BAC0667 Protein 3e-34 89
ST548_p1174 YP_007386290.1 Mercuric resistance operon coregulator BAC0227 Protein 7e-32 89
ST548_p1174 YP_007386290.1 Mercuric resistance operon coregulator BAC0669 Protein 2e-33 84