Gene Information

Name : ST548_p6878 (ST548_p6878)
Accession : YP_007387720.1
Strain : Enterobacter aerogenes EA1509E
Genome accession: NC_020181
Putative virulence/resistance : Resistance
Product : Multiple antibiotic resistance protein MarA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1426289 - 1426672 bp
Length : 384 bp
Strand : +
Note : -

DNA sequence :
ATGTCCAGACGCAATAACGACGCCATCACTATCCATAGTATTTTGTCGTGGATCGAAGAGAACCTGGAATCTCCATTGTC
GCTGGAGAAAGTTTCGGAGCGCTCAGGTTACTCCAAATGGCACCTGCAAAGAATGTTCAAGAAAGAGACCGGCCACTCGC
TGGGCCAGTACATCCGCAGTCGTAAGCTGACGGAGATTGCGCAAAAACTCAAGCAGAGCAACGAGCCAATTTTGTATCTG
GCTGAACGTTACGGTTTTGAATCGCAACAGACGCTGACGCGAACGTTTAAAAACTACTTCGATGTTCCGCCGCACAAATA
TCGCATCACCAACGTTCCGGGAGAATCCCGCTACCTGATGCCGCTAAATAATTATTGTTGTTAA

Protein sequence :
MSRRNNDAITIHSILSWIEENLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKLTEIAQKLKQSNEPILYL
AERYGFESQQTLTRTFKNYFDVPPHKYRITNVPGESRYLMPLNNYCC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 4e-21 47
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 4e-21 47
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-19 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA CP000647.1.gene1624. Protein 1e-53 99
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA CP001918.1.gene2033. Protein 6e-52 93
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA CP001138.1.gene1637. Protein 5e-52 92
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA BAC0560 Protein 2e-52 90
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA NC_002695.1.917339.p Protein 2e-52 90
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA CP000034.1.gene1596. Protein 3e-52 89
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA NC_010558.1.6276025. Protein 2e-21 47
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA CP001138.1.gene612.p Protein 6e-22 45
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA BAC0371 Protein 8e-20 44
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA CP000034.1.gene4505. Protein 2e-19 44
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA NC_002695.1.914293.p Protein 8e-20 44
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA CP001138.1.gene4488. Protein 7e-20 44
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA CP001918.1.gene327.p Protein 5e-20 44
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA CP000647.1.gene4499. Protein 1e-19 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA VFG1038 Protein 2e-21 47
ST548_p6878 YP_007387720.1 Multiple antibiotic resistance protein MarA VFG0585 Protein 6e-20 44