Gene Information

Name : ST548_p4778 (ST548_p4778)
Accession : YP_007389820.1
Strain : Enterobacter aerogenes EA1509E
Genome accession: NC_020181
Putative virulence/resistance : Resistance
Product : Regulatory protein SoxS
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3605250 - 3605579 bp
Length : 330 bp
Strand : +
Note : -

DNA sequence :
ATGTCCCATCAGGATATTATCCAAACGCTTATTGAATGGATTGATGAACATATCGATCAACCACTTAACATTGATGTAGT
CGCTAAAAAATCGGGATACTCGAAATGGTATCTACAGCGGATGTTCCGTACCGTCACCCACCAAACGCTGGGTGATTACA
TTCGCCAGCGCCGGCTACTGCTCGCCGCTGAGGCGCTAAGGACCACGCAACGCCCTATTTTTGATATTGCGATGGATTTG
GGATACGTCTCGCAACAGACGTTCTCACGGGTGTTCCGCCGGGAGTTCGATCGCACTCCCAGCGACTACCGTCATCAGAT
TTCCGCCTGA

Protein sequence :
MSHQDIIQTLIEWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGDYIRQRRLLLAAEALRTTQRPIFDIAMDL
GYVSQQTFSRVFRREFDRTPSDYRHQISA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 3e-36 94
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 3e-15 48
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 3e-15 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ST548_p4778 YP_007389820.1 Regulatory protein SoxS CP000647.1.gene4499. Protein 1e-37 98
ST548_p4778 YP_007389820.1 Regulatory protein SoxS CP001138.1.gene4488. Protein 9e-37 94
ST548_p4778 YP_007389820.1 Regulatory protein SoxS CP001918.1.gene327.p Protein 5e-37 94
ST548_p4778 YP_007389820.1 Regulatory protein SoxS NC_002695.1.914293.p Protein 7e-36 92
ST548_p4778 YP_007389820.1 Regulatory protein SoxS BAC0371 Protein 7e-36 92
ST548_p4778 YP_007389820.1 Regulatory protein SoxS CP000034.1.gene4505. Protein 1e-35 91
ST548_p4778 YP_007389820.1 Regulatory protein SoxS CP001138.1.gene612.p Protein 2e-18 48
ST548_p4778 YP_007389820.1 Regulatory protein SoxS NC_010558.1.6276025. Protein 2e-15 48
ST548_p4778 YP_007389820.1 Regulatory protein SoxS CP000647.1.gene1624. Protein 4e-16 43
ST548_p4778 YP_007389820.1 Regulatory protein SoxS CP001918.1.gene2033. Protein 3e-16 43
ST548_p4778 YP_007389820.1 Regulatory protein SoxS NC_002695.1.917339.p Protein 2e-16 42
ST548_p4778 YP_007389820.1 Regulatory protein SoxS CP001138.1.gene1637. Protein 2e-16 42
ST548_p4778 YP_007389820.1 Regulatory protein SoxS BAC0560 Protein 2e-16 42
ST548_p4778 YP_007389820.1 Regulatory protein SoxS CP000034.1.gene1596. Protein 2e-16 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ST548_p4778 YP_007389820.1 Regulatory protein SoxS VFG0585 Protein 8e-37 94
ST548_p4778 YP_007389820.1 Regulatory protein SoxS VFG1038 Protein 1e-15 48