Gene Information

Name : M7W_2379 (M7W_2379)
Accession : YP_007395038.1
Strain : Enterococcus faecium NRRL B-2354
Genome accession: NC_020207
Putative virulence/resistance : Virulence
Product : Two-component response regulator SA14-24
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2240115 - 2240819 bp
Length : 705 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAAAGTTTTAGTTGTCGATGATGAGAAGCCGATTTCGGATATCGTCAAATTCAATTTAGCCAAAGAAGGCTATGA
TGTTTATACTGCATATGATGGGGAAGAAGCCTTGGAAAAAGTTGCTGAGGTAGAACCTGATTTGATTTTACTTGATTTGA
TGCTACCTAAAATGGACGGCTTAGAAGTTGCTCGTGAGGTACGCAAAACTTATGATATGCCGATCATTATGGTAACAGCC
AAAGATTCTGAAATTGATAAAGTCCTAGGCTTAGAGTTAGGCGCCGATGATTACGTGACCAAGCCATTTTCCAACCGAGA
ATTAGTTGCACGTGTCAAAGCAAATCTTCGTCGCGGTGCCACGGCTGCGAAGGAACCAGAAGAGGCAGCACCTGCGGAAT
TGACGATTGGTGATTTGACGATCCATCCAGAAGCTTACATGGTGACGAAACGAGGAGAAACAATCGAGTTAACACATCGT
GAATTCGAACTACTCTTTTACTTGGCGAAGCACCTTGGACAAGTGATGACAAGAGAACATTTATTACAAACGGTTTGGGG
TTATGATTATTTTGGAGATGTACGAACAGTGGATGTAACTGTACGTCGTTTGCGTGAAAAGATCGAAGATAATCCAAGCC
ATCCAAATTATTTAGTGACACGTCGTGGTGTCGGTTACTATTTGCGTAACCCAGAACAGGAGTAA

Protein sequence :
MKKVLVVDDEKPISDIVKFNLAKEGYDVYTAYDGEEALEKVAEVEPDLILLDLMLPKMDGLEVAREVRKTYDMPIIMVTA
KDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRRGATAAKEPEEAAPAELTIGDLTIHPEAYMVTKRGETIELTHR
EFELLFYLAKHLGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNYLVTRRGVGYYLRNPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_012469.1.7685629. Protein 7e-67 69
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_002952.2859905.p0 Protein 7e-51 54
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_007622.3794472.p0 Protein 5e-51 54
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_002745.1124361.p0 Protein 7e-51 54
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_009782.5559369.p0 Protein 7e-51 54
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_002951.3237708.p0 Protein 7e-51 54
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_003923.1003749.p0 Protein 7e-51 54
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_002758.1121668.p0 Protein 7e-51 54
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_009641.5332272.p0 Protein 7e-51 54
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_013450.8614421.p0 Protein 7e-51 54
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_007793.3914279.p0 Protein 7e-51 54
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 HE999704.1.gene2815. Protein 2e-45 52
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_012469.1.7686381. Protein 2e-39 51
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 AE016830.1.gene1681. Protein 2e-44 49
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 BAC0533 Protein 1e-32 47
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 CP000647.1.gene4257. Protein 1e-32 47
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 AF155139.2.orf0.gene Protein 6e-37 46
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 AE000516.2.gene3505. Protein 2e-35 46
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 CP001138.1.gene4273. Protein 2e-32 46
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 CP004022.1.gene3215. Protein 4e-36 46
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 FJ349556.1.orf0.gene Protein 1e-39 45
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_002695.1.915041.p Protein 3e-32 45
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 CP000034.1.gene3834. Protein 3e-32 45
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 HE999704.1.gene1528. Protein 1e-30 43
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 AM180355.1.gene1830. Protein 2e-37 43
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_003923.1003417.p0 Protein 4e-35 43
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_013450.8614146.p0 Protein 4e-35 43
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_002951.3238224.p0 Protein 4e-35 43
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_007793.3914065.p0 Protein 4e-35 43
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_002758.1121390.p0 Protein 4e-35 43
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_010079.5776364.p0 Protein 4e-35 43
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_002952.2859858.p0 Protein 4e-35 43
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_007622.3794948.p0 Protein 4e-35 43
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 BAC0039 Protein 1e-28 43
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 CP000034.1.gene2186. Protein 1e-28 43
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_002695.1.916589.p Protein 1e-28 43
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 AF130997.1.orf0.gene Protein 5e-35 42
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 DQ212986.1.gene4.p01 Protein 4e-36 42
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 CP001918.1.gene3444. Protein 9e-28 42
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 CP001138.1.gene2239. Protein 2e-27 42
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 BAC0596 Protein 2e-27 42
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_014475.1.orf0.gen Protein 8e-34 41
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 NC_005054.2598277.p0 Protein 8e-34 41
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 AF162694.1.orf4.gene Protein 3e-31 41
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 AE015929.1.gene1106. Protein 8e-30 41
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 CP000647.1.gene2531. Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 VFG1386 Protein 2e-32 44
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 VFG1389 Protein 6e-28 43
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 VFG1390 Protein 2e-31 41
M7W_2379 YP_007395038.1 Two-component response regulator SA14-24 VFG1702 Protein 1e-31 41