Gene Information

Name : H045_10815 (H045_10815)
Accession : YP_007397724.1
Strain : Pseudomonas poae RE*1-1-14
Genome accession: NC_020209
Putative virulence/resistance : Virulence
Product : putative two-component response regulator transcriptional regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2498119 - 2498802 bp
Length : 684 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGACCCGTATTTTGACCATCGAGGATGACGCCGTAACGGCCCGCGAGATCGTCGCCGAGCTGAGTAGCCATGGACTGGA
GGTAGACTGGGTGGACAATGGCCGTGAAGGCCTGGTCCGCGCCGTGAGTGGTGATTACGATCTGATCACCCTCGACCGAA
TGCTGCCGGAACTGGATGGCCTGGCCATCGTTACCACCCTGCGCACCATCGGCGTTTCCACGCCGATCCTGATGATCAGC
GCCCTCTCCGACGTTGACGAGCGTGTGCGTGGCCTGCGTGCCGGCGGTGACGATTATCTGACCAAACCCTTTGCCTCCGA
TGAAATGGCCGCCCGCGTCGAAGTGCTGCTGCGCCGCAAAAGCACGGTCAAGGAGTTCGAAACCGCGCTGCGCGTGGCGG
ACCTGGAACTGAACCTGATCAGCCGCGAAGCCAGTCGCGCCGAGCAGCCACTGACCCTGCTGCCCACCGAATACAAACTG
CTCGAATTCCTGATGCGCAACACCGGGCAAATCCTCTCGCGCATGATGATCTTCGAGGAAGTCTGGGGGTATCACTTCGA
CCCCGGCACCAACCTGATCGACGTGCACATCGGGCGCCTGCGCAAGAAGATCGATCCCCCGGGCCTCACGCCGCTGATTC
GCACGGTACGGGGCTCGGGTTATGTCATTGCTGAACCCCTCTAA

Protein sequence :
MTRILTIEDDAVTAREIVAELSSHGLEVDWVDNGREGLVRAVSGDYDLITLDRMLPELDGLAIVTTLRTIGVSTPILMIS
ALSDVDERVRGLRAGGDDYLTKPFASDEMAARVEVLLRRKSTVKEFETALRVADLELNLISREASRAEQPLTLLPTEYKL
LEFLMRNTGQILSRMMIFEEVWGYHFDPGTNLIDVHIGRLRKKIDPPGLTPLIRTVRGSGYVIAEPL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-33 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H045_10815 YP_007397724.1 putative two-component response regulator transcriptional regulatory protein BAC0111 Protein 5e-43 46
H045_10815 YP_007397724.1 putative two-component response regulator transcriptional regulatory protein BAC0125 Protein 1e-38 46
H045_10815 YP_007397724.1 putative two-component response regulator transcriptional regulatory protein BAC0197 Protein 2e-39 46
H045_10815 YP_007397724.1 putative two-component response regulator transcriptional regulatory protein BAC0347 Protein 2e-40 45
H045_10815 YP_007397724.1 putative two-component response regulator transcriptional regulatory protein BAC0308 Protein 5e-40 44
H045_10815 YP_007397724.1 putative two-component response regulator transcriptional regulatory protein BAC0083 Protein 9e-41 42
H045_10815 YP_007397724.1 putative two-component response regulator transcriptional regulatory protein HE999704.1.gene1528. Protein 3e-28 41
H045_10815 YP_007397724.1 putative two-component response regulator transcriptional regulatory protein NC_012469.1.7686381. Protein 3e-37 41
H045_10815 YP_007397724.1 putative two-component response regulator transcriptional regulatory protein BAC0638 Protein 5e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H045_10815 YP_007397724.1 putative two-component response regulator transcriptional regulatory protein VFG1390 Protein 6e-38 43
H045_10815 YP_007397724.1 putative two-component response regulator transcriptional regulatory protein VFG0596 Protein 3e-33 43
H045_10815 YP_007397724.1 putative two-component response regulator transcriptional regulatory protein VFG1389 Protein 1e-31 42