Gene Information

Name : H045_00110 (H045_00110)
Accession : YP_007395594.1
Strain : Pseudomonas poae RE*1-1-14
Genome accession: NC_020209
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 27324 - 27998 bp
Length : 675 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCGCATCCTGGTTGTTGAGGACGAGCAGAAAACCGCCGACTACCTGCAGCAAGGCCTGACCGAAAGCGGTTACGTCGT
CGACTGCGCCGCCAGCGGCATCGATGGCTTGCACTTGGCGCGGCAACACAGCTATGAACTGGTGATCCTCGATGTCAATT
TGCCCAACACCGATGGTTGGGGCGTGCTCGAGCAATTACGCCGCGATGGCAACCAACGCGTGATGATGCTGACGGCACGC
GGTCGCCTGGCCGACAAGATCAAAGGCCTGGACATGGGCGCCGACGATTACCTGGTCAAGCCCTTTGAATTCCCCGAATT
ACTGGCCCGCGTGCGCACCCTGTTGCGTCGCAGCGAACATATCCCGCTGCCGGAGGTGCTGCGCGTTTCGGACCTGGAGT
TGGACCCGCGCCGGCATCGAGCCTACCGCGGCAACCGACGTATCGACCTGACCACCAAGGAGTTCGCGCTGCTGCATGTG
TTGATGCGCCAGAGCGGCGAGGTGATGACCCGCACGCAGATCATTTCCCTGGTGTGGGACATGAACTTCGATTGCGACAC
CAACGTGGTGGAAGTGTCCATCAGCCGTCTGCGCGCCAAGGTCGATGACCAGAGCGAGGTCAAGCTGATCCACACCATAC
GCGGCGTGGGCTATGTGTTGGAGGCGCGCCAATGA

Protein sequence :
MRILVVEDEQKTADYLQQGLTESGYVVDCAASGIDGLHLARQHSYELVILDVNLPNTDGWGVLEQLRRDGNQRVMMLTAR
GRLADKIKGLDMGADDYLVKPFEFPELLARVRTLLRRSEHIPLPEVLRVSDLELDPRRHRAYRGNRRIDLTTKEFALLHV
LMRQSGEVMTRTQIISLVWDMNFDCDTNVVEVSISRLRAKVDDQSEVKLIHTIRGVGYVLEARQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-54 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-54 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H045_00110 YP_007395594.1 two-component system response regulator BAC0125 Protein 1e-61 57
H045_00110 YP_007395594.1 two-component system response regulator BAC0197 Protein 8e-62 57
H045_00110 YP_007395594.1 two-component system response regulator BAC0083 Protein 2e-60 56
H045_00110 YP_007395594.1 two-component system response regulator BAC0638 Protein 2e-55 56
H045_00110 YP_007395594.1 two-component system response regulator BAC0308 Protein 6e-57 54
H045_00110 YP_007395594.1 two-component system response regulator BAC0111 Protein 8e-60 51
H045_00110 YP_007395594.1 two-component system response regulator BAC0347 Protein 2e-55 50
H045_00110 YP_007395594.1 two-component system response regulator NC_002951.3238224.p0 Protein 5e-37 42
H045_00110 YP_007395594.1 two-component system response regulator NC_007793.3914065.p0 Protein 5e-37 42
H045_00110 YP_007395594.1 two-component system response regulator NC_002758.1121390.p0 Protein 5e-37 42
H045_00110 YP_007395594.1 two-component system response regulator NC_010079.5776364.p0 Protein 5e-37 42
H045_00110 YP_007395594.1 two-component system response regulator NC_002952.2859858.p0 Protein 5e-37 42
H045_00110 YP_007395594.1 two-component system response regulator NC_007622.3794948.p0 Protein 5e-37 42
H045_00110 YP_007395594.1 two-component system response regulator NC_003923.1003417.p0 Protein 5e-37 42
H045_00110 YP_007395594.1 two-component system response regulator NC_013450.8614146.p0 Protein 5e-37 42
H045_00110 YP_007395594.1 two-component system response regulator AE015929.1.gene1106. Protein 3e-33 42
H045_00110 YP_007395594.1 two-component system response regulator U82965.2.orf14.gene. Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H045_00110 YP_007395594.1 two-component system response regulator VFG0596 Protein 1e-54 54
H045_00110 YP_007395594.1 two-component system response regulator VFG1390 Protein 2e-41 44
H045_00110 YP_007395594.1 two-component system response regulator VFG1389 Protein 2e-36 43
H045_00110 YP_007395594.1 two-component system response regulator VFG1386 Protein 2e-36 42