Gene Information

Name : H045_22390 (H045_22390)
Accession : YP_007400032.1
Strain : Pseudomonas poae RE*1-1-14
Genome accession: NC_020209
Putative virulence/resistance : Unknown
Product : ISPsy24, transposase orfA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5093442 - 5093750 bp
Length : 309 bp
Strand : -
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGACCAAACAACGCCGCTCCTTTACTACTGAATTTAAGCGCGAGGCTGCCGACCTTGTGCTCAAACAAAACTACAGCTA
CATCGAAGCCAGCCGCTCACTCGGTATTGGTGAGTCGGCATTGCGCCGCTGGGTTGACCAGATTCAGAAAGAACATAAAG
GCGTCACCCCGCAGAGCAAGACCCTGACTCCGGAACAGCAAAAAATTCAGGAGCTGGAAGCCCGGATTGCTCGGCTTGAG
CGAGAGAAATCAATACTAAAAAAGGCTACCGCGCTCTTGATGTCGGAAGATCACGAGCGTTCGCGCTGA

Protein sequence :
MTKQRRSFTTEFKREAADLVLKQNYSYIEASRSLGIGESALRRWVDQIQKEHKGVTPQSKTLTPEQQKIQELEARIARLE
REKSILKKATALLMSEDHERSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-27 73
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-15 54
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-15 54
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-15 54
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-15 54
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-15 54
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-15 54
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-15 54
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-15 54
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 9e-15 52
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-16 49
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-16 49
api80 CAF28554.1 putative transposase Not tested YAPI Protein 4e-13 47
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 6e-17 47
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 9e-17 47
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-15 46
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-15 46
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-15 46
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-15 46
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-15 46
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 3e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H045_22390 YP_007400032.1 ISPsy24, transposase orfA VFG1123 Protein 1e-15 54
H045_22390 YP_007400032.1 ISPsy24, transposase orfA VFG1553 Protein 4e-15 52
H045_22390 YP_007400032.1 ISPsy24, transposase orfA VFG1485 Protein 6e-17 49
H045_22390 YP_007400032.1 ISPsy24, transposase orfA VFG0784 Protein 6e-16 46