Gene Information

Name : ykoG (GHH_c22460)
Accession : YP_007402508.1
Strain : Geobacillus sp. GHH01
Genome accession: NC_020210
Putative virulence/resistance : Virulence
Product : two-component sensor histidine kinase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2267985 - 2268659 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
ATGAACGGACGTATTTTATTGATTGAAGATGAAGCCGGGCTCGCCCGGTTTTTGGAGCTTGACTTAAAGCACGAAGGCTT
TGACGTGCATGTATGCGCCGATGGACGCGAAGGGCTCGAGCTCGCTCTTTCGGAGCAGTGGGATCTCATTTTGCTTGATG
TGATGCTGCCGAGTCTCAATGGCATGGAAGTATGCCGCCGCATCCGGGCGGCGAAATCGACGCCGATCATGATGATCACA
GCGCGCGACAGCGTGTTTGACCGCGTCATGGGACTCGATAACGGGGCCGATGACTACATCGTCAAACCGTTTGCCATTGA
AGAGCTGCTCGCCCGCATCCGCGCCTTGTTCCGCCGCGTTCATCCGGAAGCGAACGCCCAAGTGTTGACGTTTAAAGATT
TAGTCGTTGACGTGCAGGCGCGCACCGTGAAAAAAGGAGACGAATTTATTGAGCTGACGAAGCGGGAATACGACTTGCTC
GTCGCCTTTATGCAAAACATCAATGTCGTCTTGACGCGTGATGCGCTCCTTGACAAAGTGTGGGGATTTGACGCCGAAGT
CGAGACGAACGTCGTTGACGTCTATGTCCGCTACTTGCGGCAAAAGCTTGACGAACACGATAAAGAGCGGTATATCCAAA
CGGTGCGCGGCACGGGATATGTGATGCGGCCATGA

Protein sequence :
MNGRILLIEDEAGLARFLELDLKHEGFDVHVCADGREGLELALSEQWDLILLDVMLPSLNGMEVCRRIRAAKSTPIMMIT
ARDSVFDRVMGLDNGADDYIVKPFAIEELLARIRALFRRVHPEANAQVLTFKDLVVDVQARTVKKGDEFIELTKREYDLL
VAFMQNINVVLTRDALLDKVWGFDAEVETNVVDVYVRYLRQKLDEHDKERYIQTVRGTGYVMRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-35 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-34 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-36 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_007402508.1 two-component sensor histidine kinase HE999704.1.gene1528. Protein 6e-70 66
ykoG YP_007402508.1 two-component sensor histidine kinase NC_007793.3914065.p0 Protein 2e-56 55
ykoG YP_007402508.1 two-component sensor histidine kinase NC_002758.1121390.p0 Protein 2e-56 55
ykoG YP_007402508.1 two-component sensor histidine kinase NC_010079.5776364.p0 Protein 2e-56 55
ykoG YP_007402508.1 two-component sensor histidine kinase NC_002952.2859858.p0 Protein 2e-56 55
ykoG YP_007402508.1 two-component sensor histidine kinase NC_007622.3794948.p0 Protein 2e-56 55
ykoG YP_007402508.1 two-component sensor histidine kinase NC_003923.1003417.p0 Protein 2e-56 55
ykoG YP_007402508.1 two-component sensor histidine kinase NC_013450.8614146.p0 Protein 2e-56 55
ykoG YP_007402508.1 two-component sensor histidine kinase NC_002951.3238224.p0 Protein 2e-56 55
ykoG YP_007402508.1 two-component sensor histidine kinase AE015929.1.gene1106. Protein 7e-53 54
ykoG YP_007402508.1 two-component sensor histidine kinase BAC0125 Protein 2e-38 44
ykoG YP_007402508.1 two-component sensor histidine kinase BAC0308 Protein 3e-38 44
ykoG YP_007402508.1 two-component sensor histidine kinase AE000516.2.gene3505. Protein 2e-38 44
ykoG YP_007402508.1 two-component sensor histidine kinase BAC0197 Protein 5e-36 43
ykoG YP_007402508.1 two-component sensor histidine kinase CP001485.1.gene721.p Protein 1e-32 42
ykoG YP_007402508.1 two-component sensor histidine kinase NC_012469.1.7685629. Protein 3e-40 42
ykoG YP_007402508.1 two-component sensor histidine kinase NC_012469.1.7686381. Protein 2e-44 42
ykoG YP_007402508.1 two-component sensor histidine kinase BAC0083 Protein 1e-38 42
ykoG YP_007402508.1 two-component sensor histidine kinase HE999704.1.gene2815. Protein 3e-39 41
ykoG YP_007402508.1 two-component sensor histidine kinase BAC0111 Protein 2e-37 41
ykoG YP_007402508.1 two-component sensor histidine kinase BAC0638 Protein 8e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_007402508.1 two-component sensor histidine kinase VFG1390 Protein 2e-47 47
ykoG YP_007402508.1 two-component sensor histidine kinase VFG0596 Protein 1e-35 43
ykoG YP_007402508.1 two-component sensor histidine kinase VFG1389 Protein 2e-39 43
ykoG YP_007402508.1 two-component sensor histidine kinase VFG1563 Protein 5e-36 41
ykoG YP_007402508.1 two-component sensor histidine kinase VFG1702 Protein 2e-36 41