Gene Information

Name : SMWW4_v1c14870 (SMWW4_v1c14870)
Accession : YP_007405310.1
Strain : Serratia marcescens WW4
Genome accession: NC_020211
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1624697 - 1625416 bp
Length : 720 bp
Strand : -
Note : -

DNA sequence :
ATGAGAATGGACAAGCCAAAACGAATTTTGATCGTCGAGGACGACGGCGACATCGCCGATCTGCTGCAGCTGCATCTGCG
TGACGAGGGTTACGCCATCAGCCACGCCGCCGACGGCAATCAGGGCATGGCGATGCTGGAACAGGGCGGCTGGGACGCCC
TCATCCTCGATCTGATGTTGCCGGGCGTCGACGGATTGGAGATTTGCCGCCGGGCGCGCACCATGACGCGCTACACGCCG
ATCATCATCACCAGCGCGCGCTCCAGCGAGGTGCACCGCGTGCTGGGGCTGGAGCTGGGCGCTGACGACTATCTGGCCAA
ACCTTTTTCCATGCTGGAGCTGGTGGCGCGGGTCAAGGCGCTGTTTCGCCGCCAGGAGGCGATGAGCCGCAACCTGCGCC
TGGACGCCGGCGCGCTCAGCTTCAACGATCTGACCATCGATCCTATCGCCCGCGAGGTGCGCCTGCACCAACAGCCGATC
GAGCTGACGCCGCGCGAATTCGACCTGCTGTACTTTTTCGCCCGCCACCCGGGCCAGGTATTCTCGCGCCTCAGCCTGTT
GAATCAGGTCTGGGGCTATCAGCACGAAGGGTATGAGCACACCGTCAACACCCATATCAACCGGCTGCGCATCAAGATTG
AGCGCAATCCGGCGGAACCCGAGCGCATCCTCACGGTGTGGGGCATGGGCTATAAATTCGCGGCCGCGCCGCAAGAGTGA

Protein sequence :
MRMDKPKRILIVEDDGDIADLLQLHLRDEGYAISHAADGNQGMAMLEQGGWDALILDLMLPGVDGLEICRRARTMTRYTP
IIITSARSSEVHRVLGLELGADDYLAKPFSMLELVARVKALFRRQEAMSRNLRLDAGALSFNDLTIDPIAREVRLHQQPI
ELTPREFDLLYFFARHPGQVFSRLSLLNQVWGYQHEGYEHTVNTHINRLRIKIERNPAEPERILTVWGMGYKFAAAPQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-78 67
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-77 66

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator NC_012469.1.7685629. Protein 4e-42 45
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator AE000516.2.gene3505. Protein 4e-40 44
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-31 42
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 4e-42 42
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-44 42
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator NC_012469.1.7686381. Protein 9e-42 42
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-35 41
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-35 41
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-35 41
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-35 41
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-35 41
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-35 41
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-35 41
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-35 41
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-39 41
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator HE999704.1.gene1528. Protein 8e-36 41
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator HE999704.1.gene2815. Protein 8e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator VFG1702 Protein 4e-78 67
SMWW4_v1c14870 YP_007405310.1 two component transcriptional regulator VFG1563 Protein 3e-77 66