Gene Information

Name : rrp7 (zj316_2437)
Accession : YP_007415122.1
Strain : Lactobacillus plantarum ZJ316
Genome accession: NC_020229
Putative virulence/resistance : Virulence
Product : Two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2467352 - 2468080 bp
Length : 729 bp
Strand : -
Note : -

DNA sequence :
ATGAAATTATTAATGATTGAAGATAATAAATCGGTCTCTGAAATGATGGCCATGTTTTTTAAGAAGGAAAAGTGGGATGC
CCATTTTGCTTATGATGGCAATGAAGCTGTCGAAATGTTCAATGAAGATGTCGATGGCTGGGATATGGTGACGCTCGACT
TGAACTTGCCAGGCAAGGATGGCATGCAAGTTAGTGCGGATATTCGCAAGGCTTCCCCAACTGTACCAATTATTATGTTG
ACGGCCCGTGATTCGGAAAGTGATCAGGTACTTGGCTTAGAGATGGGCGCTGATGATTATGTCACCAAGCCGTTTTCACC
GATTACACTGATTGCTCGGATCAAGGCCCTTCATCGCCGAGCAGATTTGGCTAAGACCACGCCGGCTGACCAACCTGCCA
GCACGGTGAGTTCCTTTGATGTTCAGACGGACCATTTTAAACTGAATACCAAGACGCGGGAAGCCTATTTAGCAGACAAA
CAAATTCAAGACTTGACCCCCAAAGAATTTGATTTATTGAAGACCTTAGCTCAAAAGCCGCGGCAAGTTTTCTCACGCGA
ACAACTTTTGCAACTGGTCTGGGATTATGAATATTATGGTGACGAACGTACTGTGGATGCACATATCAAAAAATTGCGCC
AAAAGATTGAAAAAGCTGGGCCACAAATTATTCAGACGGTTTGGGGGGTCGGCTACAAGTTTGATGATAGTGGAGTTGAC
GCTCAATGA

Protein sequence :
MKLLMIEDNKSVSEMMAMFFKKEKWDAHFAYDGNEAVEMFNEDVDGWDMVTLDLNLPGKDGMQVSADIRKASPTVPIIML
TARDSESDQVLGLEMGADDYVTKPFSPITLIARIKALHRRADLAKTTPADQPASTVSSFDVQTDHFKLNTKTREAYLADK
QIQDLTPKEFDLLKTLAQKPRQVFSREQLLQLVWDYEYYGDERTVDAHIKKLRQKIEKAGPQIIQTVWGVGYKFDDSGVD
AQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-39 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-38 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rrp7 YP_007415122.1 Two-component system response regulator NC_012469.1.7685629. Protein 3e-41 44
rrp7 YP_007415122.1 Two-component system response regulator AE000516.2.gene3505. Protein 3e-34 42
rrp7 YP_007415122.1 Two-component system response regulator CP001918.1.gene5135. Protein 2e-19 42
rrp7 YP_007415122.1 Two-component system response regulator NC_002952.2859905.p0 Protein 2e-42 41
rrp7 YP_007415122.1 Two-component system response regulator NC_009782.5559369.p0 Protein 2e-42 41
rrp7 YP_007415122.1 Two-component system response regulator NC_002951.3237708.p0 Protein 2e-42 41
rrp7 YP_007415122.1 Two-component system response regulator NC_002758.1121668.p0 Protein 2e-42 41
rrp7 YP_007415122.1 Two-component system response regulator NC_007622.3794472.p0 Protein 2e-42 41
rrp7 YP_007415122.1 Two-component system response regulator NC_009641.5332272.p0 Protein 2e-42 41
rrp7 YP_007415122.1 Two-component system response regulator NC_013450.8614421.p0 Protein 2e-42 41
rrp7 YP_007415122.1 Two-component system response regulator NC_007793.3914279.p0 Protein 2e-42 41
rrp7 YP_007415122.1 Two-component system response regulator NC_003923.1003749.p0 Protein 2e-42 41
rrp7 YP_007415122.1 Two-component system response regulator NC_002745.1124361.p0 Protein 2e-42 41
rrp7 YP_007415122.1 Two-component system response regulator HE999704.1.gene2815. Protein 6e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rrp7 YP_007415122.1 Two-component system response regulator VFG1563 Protein 5e-39 42
rrp7 YP_007415122.1 Two-component system response regulator VFG1702 Protein 4e-39 42