Gene Information

Name : rrp1 (zj316_0257)
Accession : YP_007412942.1
Strain : Lactobacillus plantarum ZJ316
Genome accession: NC_020229
Putative virulence/resistance : Virulence
Product : Two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 281915 - 282622 bp
Length : 708 bp
Strand : +
Note : -

DNA sequence :
ATGAAAAAAATCTTAGTAGTTGATGATGAAAAGCCCATCTCTGATATCATGAAATTTAATCTGACCAAAGAAGGCTATGA
AGTTCACGTTGCAGCTGACGGAGAGGAAGCCTTACAAAAAGTGGATGAAGTCCACCCTGATTTGATTTTGTTAGATTTGA
TGTTGCCTAAGATGGATGGCTTGGAAGTTGCTCGACAAGTACGGAAGAACTATGATATGCCAATTATCATGGTAACGGCA
AAGGACTCTGAATTAGACAAGGTGTTGGGCTTGGAACTGGGCGCGGACGACTATGTGACCAAACCGTTCTCAAACCGGGA
ACTCGTGGCTCGAGTCAAAGCAAATCTACGGCGGCAAGGTGCACCAAGTGCTCAACCAGCTGAAGTTGAAGAAAATTCAG
ACATTGAAATTGGCGATCTGGTGATTCATCCAGAAGCTTATATGGTTTCCAAACGCGGTGAAAACATCGAATTAACGCAC
CGTGAATTTGAACTGTTACATTACTTAGCCCAACATATCGGCCAAGTCATGACGCGGGAACACTTGTTGCAGACGGTCTG
GGGCTATGATTACTTTGGTGATGTCCGGACAGTTGATGTGACCGTGCGGCGGTTACGTGAAAAAGTTGAAGATAACCCGA
GTCATCCAAAATGGCTGGTGACGCGGCGGGGCGTGGGTTACTATCTCCGCAATCCTGAAAATGAGTAG

Protein sequence :
MKKILVVDDEKPISDIMKFNLTKEGYEVHVAADGEEALQKVDEVHPDLILLDLMLPKMDGLEVARQVRKNYDMPIIMVTA
KDSELDKVLGLELGADDYVTKPFSNRELVARVKANLRRQGAPSAQPAEVEENSDIEIGDLVIHPEAYMVSKRGENIELTH
REFELLHYLAQHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKVEDNPSHPKWLVTRRGVGYYLRNPENE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-33 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rrp1 YP_007412942.1 Two-component system response regulator NC_012469.1.7685629. Protein 9e-68 69
rrp1 YP_007412942.1 Two-component system response regulator NC_013450.8614421.p0 Protein 6e-52 55
rrp1 YP_007412942.1 Two-component system response regulator NC_007793.3914279.p0 Protein 6e-52 55
rrp1 YP_007412942.1 Two-component system response regulator NC_003923.1003749.p0 Protein 7e-52 55
rrp1 YP_007412942.1 Two-component system response regulator NC_002745.1124361.p0 Protein 6e-52 55
rrp1 YP_007412942.1 Two-component system response regulator NC_009782.5559369.p0 Protein 6e-52 55
rrp1 YP_007412942.1 Two-component system response regulator NC_002951.3237708.p0 Protein 6e-52 55
rrp1 YP_007412942.1 Two-component system response regulator NC_002952.2859905.p0 Protein 1e-51 55
rrp1 YP_007412942.1 Two-component system response regulator NC_007622.3794472.p0 Protein 5e-52 55
rrp1 YP_007412942.1 Two-component system response regulator NC_002758.1121668.p0 Protein 6e-52 55
rrp1 YP_007412942.1 Two-component system response regulator NC_009641.5332272.p0 Protein 6e-52 55
rrp1 YP_007412942.1 Two-component system response regulator HE999704.1.gene2815. Protein 4e-48 52
rrp1 YP_007412942.1 Two-component system response regulator FJ349556.1.orf0.gene Protein 3e-41 48
rrp1 YP_007412942.1 Two-component system response regulator NC_012469.1.7686381. Protein 2e-41 47
rrp1 YP_007412942.1 Two-component system response regulator AE000516.2.gene3505. Protein 7e-37 47
rrp1 YP_007412942.1 Two-component system response regulator AF155139.2.orf0.gene Protein 8e-38 46
rrp1 YP_007412942.1 Two-component system response regulator AE016830.1.gene1681. Protein 8e-45 45
rrp1 YP_007412942.1 Two-component system response regulator NC_002695.1.915041.p Protein 4e-34 45
rrp1 YP_007412942.1 Two-component system response regulator CP000034.1.gene3834. Protein 4e-34 45
rrp1 YP_007412942.1 Two-component system response regulator CP001918.1.gene5135. Protein 6e-29 45
rrp1 YP_007412942.1 Two-component system response regulator CP001138.1.gene4273. Protein 2e-33 44
rrp1 YP_007412942.1 Two-component system response regulator NC_010400.5986590.p0 Protein 2e-29 44
rrp1 YP_007412942.1 Two-component system response regulator NC_011595.7057856.p0 Protein 4e-30 44
rrp1 YP_007412942.1 Two-component system response regulator NC_010410.6002989.p0 Protein 4e-30 44
rrp1 YP_007412942.1 Two-component system response regulator BAC0533 Protein 2e-33 43
rrp1 YP_007412942.1 Two-component system response regulator CP000647.1.gene4257. Protein 2e-33 43
rrp1 YP_007412942.1 Two-component system response regulator CP004022.1.gene3215. Protein 7e-39 43
rrp1 YP_007412942.1 Two-component system response regulator NC_007793.3914065.p0 Protein 2e-36 43
rrp1 YP_007412942.1 Two-component system response regulator NC_002758.1121390.p0 Protein 2e-36 43
rrp1 YP_007412942.1 Two-component system response regulator NC_010079.5776364.p0 Protein 2e-36 43
rrp1 YP_007412942.1 Two-component system response regulator NC_002952.2859858.p0 Protein 2e-36 43
rrp1 YP_007412942.1 Two-component system response regulator NC_007622.3794948.p0 Protein 2e-36 43
rrp1 YP_007412942.1 Two-component system response regulator NC_003923.1003417.p0 Protein 2e-36 43
rrp1 YP_007412942.1 Two-component system response regulator NC_013450.8614146.p0 Protein 2e-36 43
rrp1 YP_007412942.1 Two-component system response regulator NC_002951.3238224.p0 Protein 2e-36 43
rrp1 YP_007412942.1 Two-component system response regulator BAC0039 Protein 8e-32 43
rrp1 YP_007412942.1 Two-component system response regulator CP000034.1.gene2186. Protein 8e-32 43
rrp1 YP_007412942.1 Two-component system response regulator NC_002695.1.916589.p Protein 8e-32 43
rrp1 YP_007412942.1 Two-component system response regulator AM180355.1.gene1830. Protein 6e-37 42
rrp1 YP_007412942.1 Two-component system response regulator AE015929.1.gene1106. Protein 1e-32 42
rrp1 YP_007412942.1 Two-component system response regulator CP004022.1.gene1676. Protein 3e-29 42
rrp1 YP_007412942.1 Two-component system response regulator CP001138.1.gene2239. Protein 3e-30 42
rrp1 YP_007412942.1 Two-component system response regulator CP000647.1.gene2531. Protein 3e-30 42
rrp1 YP_007412942.1 Two-component system response regulator CP001918.1.gene3444. Protein 8e-31 42
rrp1 YP_007412942.1 Two-component system response regulator BAC0596 Protein 3e-30 42
rrp1 YP_007412942.1 Two-component system response regulator HE999704.1.gene1528. Protein 3e-30 41
rrp1 YP_007412942.1 Two-component system response regulator NC_014475.1.orf0.gen Protein 4e-33 41
rrp1 YP_007412942.1 Two-component system response regulator NC_005054.2598277.p0 Protein 4e-33 41
rrp1 YP_007412942.1 Two-component system response regulator AF130997.1.orf0.gene Protein 1e-34 41
rrp1 YP_007412942.1 Two-component system response regulator AF162694.1.orf4.gene Protein 8e-33 41
rrp1 YP_007412942.1 Two-component system response regulator DQ212986.1.gene4.p01 Protein 2e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rrp1 YP_007412942.1 Two-component system response regulator VFG1389 Protein 4e-32 43
rrp1 YP_007412942.1 Two-component system response regulator VFG1563 Protein 4e-33 42
rrp1 YP_007412942.1 Two-component system response regulator VFG1702 Protein 4e-33 42
rrp1 YP_007412942.1 Two-component system response regulator VFG1386 Protein 5e-35 42
rrp1 YP_007412942.1 Two-component system response regulator VFG1390 Protein 1e-35 41