Gene Information

Name : mtrA (CU7111_0473)
Accession : YP_007416312.1
Strain : Corynebacterium urealyticum DSM 7111
Genome accession: NC_020230
Putative virulence/resistance : Virulence
Product : two-component system response regulator MtrA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 565713 - 566393 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGACACCCAAGATTCTGGTGGTCGACGACGATCCGGCGATCTCGGAGATGCTCACCATCGTGCTGCAGACCGAAGGTTT
CGACACGGTCGTGGTCGGCGACGGCAACGACGCCGTCACCGCAGCCCAGGAGCATGATCCCGACCTGATCCTGCTGGACG
TCATGCTGCCCGGAATGAGCGGGATCGACGTCTGCCGCACGGTGCGCGAGTTCTCCACGGTGCCGATCGTGATGCTCACC
GCCCGTACGGACACAGTGGACGTCGTGCTCGGCCTGGAGTCCGGCGCGGATGACTACATCACCAAGCCTTTCAAGCCGAA
GGAGCTCATCGCCCGCGTGCGGGCTCGGCTGCGTCGCAGCCCGGAGGAGGCCGATGAGTCCACCACCATTCGCGTGGGAG
AGGTAGAGATCGACACGGCTGGCCATGAGGTCACCCGGGGCGGGGAGGTCATCAACCTGACCCCGATCGAGTTCGACCTG
CTGACCACCCTGGCCTCCCGGCCGGGGCAGGTGTTCAGTCGCGAGGAGCTGCTGGAGAAGGTCTGGGGTTACCGCAAGTC
CGGCGACACCCGCCTGGTGAACGTTCACGTTCAGCGCCTGCGCTCCAAGGTGGAGCGCGACCCAGATGATCCGCAGGTGG
TGCTGACCGTCCGCGGTATCGGCTATAAGTCGGGCGAGTAG

Protein sequence :
MTPKILVVDDDPAISEMLTIVLQTEGFDTVVVGDGNDAVTAAQEHDPDLILLDVMLPGMSGIDVCRTVREFSTVPIVMLT
ARTDTVDVVLGLESGADDYITKPFKPKELIARVRARLRRSPEEADESTTIRVGEVEIDTAGHEVTRGGEVINLTPIEFDL
LTTLASRPGQVFSREELLEKVWGYRKSGDTRLVNVHVQRLRSKVERDPDDPQVVLTVRGIGYKSGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-42 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-42 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_007416312.1 two-component system response regulator MtrA AE000516.2.gene3505. Protein 5e-71 70
mtrA YP_007416312.1 two-component system response regulator MtrA NC_002952.2859905.p0 Protein 4e-53 50
mtrA YP_007416312.1 two-component system response regulator MtrA NC_009641.5332272.p0 Protein 5e-53 50
mtrA YP_007416312.1 two-component system response regulator MtrA NC_013450.8614421.p0 Protein 5e-53 50
mtrA YP_007416312.1 two-component system response regulator MtrA NC_007793.3914279.p0 Protein 5e-53 50
mtrA YP_007416312.1 two-component system response regulator MtrA NC_002745.1124361.p0 Protein 5e-53 50
mtrA YP_007416312.1 two-component system response regulator MtrA NC_009782.5559369.p0 Protein 5e-53 50
mtrA YP_007416312.1 two-component system response regulator MtrA NC_002951.3237708.p0 Protein 5e-53 50
mtrA YP_007416312.1 two-component system response regulator MtrA NC_003923.1003749.p0 Protein 5e-53 50
mtrA YP_007416312.1 two-component system response regulator MtrA NC_002758.1121668.p0 Protein 5e-53 50
mtrA YP_007416312.1 two-component system response regulator MtrA NC_007622.3794472.p0 Protein 3e-53 50
mtrA YP_007416312.1 two-component system response regulator MtrA NC_012469.1.7685629. Protein 9e-48 47
mtrA YP_007416312.1 two-component system response regulator MtrA NC_012469.1.7686381. Protein 1e-47 45
mtrA YP_007416312.1 two-component system response regulator MtrA BAC0125 Protein 7e-37 45
mtrA YP_007416312.1 two-component system response regulator MtrA HE999704.1.gene2815. Protein 2e-48 45
mtrA YP_007416312.1 two-component system response regulator MtrA FJ349556.1.orf0.gene Protein 5e-41 44
mtrA YP_007416312.1 two-component system response regulator MtrA CP000675.2.gene1535. Protein 3e-42 43
mtrA YP_007416312.1 two-component system response regulator MtrA BAC0197 Protein 2e-35 43
mtrA YP_007416312.1 two-component system response regulator MtrA HE999704.1.gene1528. Protein 4e-38 42
mtrA YP_007416312.1 two-component system response regulator MtrA AE016830.1.gene1681. Protein 1e-45 42
mtrA YP_007416312.1 two-component system response regulator MtrA AF155139.2.orf0.gene Protein 7e-42 42
mtrA YP_007416312.1 two-component system response regulator MtrA NC_003923.1003417.p0 Protein 7e-41 41
mtrA YP_007416312.1 two-component system response regulator MtrA NC_013450.8614146.p0 Protein 7e-41 41
mtrA YP_007416312.1 two-component system response regulator MtrA NC_002951.3238224.p0 Protein 7e-41 41
mtrA YP_007416312.1 two-component system response regulator MtrA NC_007793.3914065.p0 Protein 7e-41 41
mtrA YP_007416312.1 two-component system response regulator MtrA NC_002758.1121390.p0 Protein 7e-41 41
mtrA YP_007416312.1 two-component system response regulator MtrA NC_010079.5776364.p0 Protein 7e-41 41
mtrA YP_007416312.1 two-component system response regulator MtrA NC_002952.2859858.p0 Protein 7e-41 41
mtrA YP_007416312.1 two-component system response regulator MtrA NC_007622.3794948.p0 Protein 7e-41 41
mtrA YP_007416312.1 two-component system response regulator MtrA BAC0083 Protein 4e-33 41
mtrA YP_007416312.1 two-component system response regulator MtrA CP001918.1.gene5135. Protein 8e-26 41
mtrA YP_007416312.1 two-component system response regulator MtrA CP000647.1.gene4257. Protein 3e-30 41
mtrA YP_007416312.1 two-component system response regulator MtrA BAC0533 Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_007416312.1 two-component system response regulator MtrA VFG1390 Protein 5e-39 43
mtrA YP_007416312.1 two-component system response regulator MtrA VFG1389 Protein 2e-33 43
mtrA YP_007416312.1 two-component system response regulator MtrA VFG1563 Protein 2e-42 41
mtrA YP_007416312.1 two-component system response regulator MtrA VFG1702 Protein 2e-42 41