Gene Information

Name : C663_3959 (C663_3959)
Accession : YP_007428988.1
Strain : Bacillus subtilis XF-1
Genome accession: NC_020244
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3998049 - 3998789 bp
Length : 741 bp
Strand : -
Note : yycF

DNA sequence :
ATGAAGTTATTCGGCAGGAGGAAAATCAAAATGATGGATAAAAAGATCCTTGTAGTAGATGATGAAAAACCGATTGCAGA
TATATTGGAATTTAACTTAAGAAAAGAAGGCTATGAAGTGCACTGTGCCCACGACGGAAACGAAGCCGTTGAAATGGTAG
AAGAGCTTCAGCCTGATTTAATTCTTTTAGATATTATGCTCCCGAATAAAGACGGCGTTGAAGTATGCCGCGAAGTCAGA
AAGAAATACGATATGCCAATCATTATGCTGACGGCTAAGGATTCAGAAATTGACAAGGTTATCGGGCTTGAAATCGGTGC
TGATGACTATGTCACAAAACCATTCAGCACACGCGAGCTCTTGGCGCGTGTAAAAGCGAACCTGCGCCGCCAGCTGACAA
CAGCGCCTGCGGAGGAAGAGCCTTCCTCTAACGAGATTCATATCGGCTCTCTCGTCATCTTCCCTGACGCGTACGTTGTA
TCAAAACGAGACGAAACAATCGAATTGACTCATCGTGAGTTCGAATTGCTTCATTATTTAGCAAAACATATCGGACAAGT
GATGACCCGTGAACATTTGCTTCAAACCGTTTGGGGCTATGATTACTTCGGCGATGTCAGAACGGTTGACGTAACAGTCC
GCCGGCTTCGCGAAAAAATCGAGGACAACCCGAGCCATCCAAATTGGATCGTCACACGCCGCGGTGTAGGTTATTACTTG
AGAAACCCAGAACAGGACTAA

Protein sequence :
MKLFGRRKIKMMDKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVEVCREVR
KKYDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRRQLTTAPAEEEPSSNEIHIGSLVIFPDAYVV
SKRDETIELTHREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWIVTRRGVGYYL
RNPEQD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-32 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C663_3959 YP_007428988.1 hypothetical protein NC_012469.1.7685629. Protein 2e-64 68
C663_3959 YP_007428988.1 hypothetical protein NC_009641.5332272.p0 Protein 6e-52 55
C663_3959 YP_007428988.1 hypothetical protein NC_013450.8614421.p0 Protein 6e-52 55
C663_3959 YP_007428988.1 hypothetical protein NC_007793.3914279.p0 Protein 6e-52 55
C663_3959 YP_007428988.1 hypothetical protein NC_002952.2859905.p0 Protein 8e-52 55
C663_3959 YP_007428988.1 hypothetical protein NC_007622.3794472.p0 Protein 4e-52 55
C663_3959 YP_007428988.1 hypothetical protein NC_002745.1124361.p0 Protein 6e-52 55
C663_3959 YP_007428988.1 hypothetical protein NC_009782.5559369.p0 Protein 6e-52 55
C663_3959 YP_007428988.1 hypothetical protein NC_002951.3237708.p0 Protein 6e-52 55
C663_3959 YP_007428988.1 hypothetical protein NC_003923.1003749.p0 Protein 6e-52 55
C663_3959 YP_007428988.1 hypothetical protein NC_002758.1121668.p0 Protein 6e-52 55
C663_3959 YP_007428988.1 hypothetical protein HE999704.1.gene2815. Protein 3e-48 54
C663_3959 YP_007428988.1 hypothetical protein AE016830.1.gene1681. Protein 4e-46 49
C663_3959 YP_007428988.1 hypothetical protein NC_012469.1.7686381. Protein 2e-43 48
C663_3959 YP_007428988.1 hypothetical protein FJ349556.1.orf0.gene Protein 1e-40 47
C663_3959 YP_007428988.1 hypothetical protein AM180355.1.gene1830. Protein 3e-38 46
C663_3959 YP_007428988.1 hypothetical protein AF155139.2.orf0.gene Protein 7e-37 45
C663_3959 YP_007428988.1 hypothetical protein HE999704.1.gene1528. Protein 3e-32 44
C663_3959 YP_007428988.1 hypothetical protein AE000516.2.gene3505. Protein 3e-37 44
C663_3959 YP_007428988.1 hypothetical protein NC_005054.2598277.p0 Protein 1e-36 43
C663_3959 YP_007428988.1 hypothetical protein NC_014475.1.orf0.gen Protein 1e-36 43
C663_3959 YP_007428988.1 hypothetical protein DQ212986.1.gene4.p01 Protein 3e-36 43
C663_3959 YP_007428988.1 hypothetical protein NC_007793.3914065.p0 Protein 5e-34 43
C663_3959 YP_007428988.1 hypothetical protein NC_002758.1121390.p0 Protein 5e-34 43
C663_3959 YP_007428988.1 hypothetical protein NC_010079.5776364.p0 Protein 5e-34 43
C663_3959 YP_007428988.1 hypothetical protein AE015929.1.gene1106. Protein 8e-31 43
C663_3959 YP_007428988.1 hypothetical protein NC_002952.2859858.p0 Protein 5e-34 43
C663_3959 YP_007428988.1 hypothetical protein NC_007622.3794948.p0 Protein 5e-34 43
C663_3959 YP_007428988.1 hypothetical protein NC_003923.1003417.p0 Protein 5e-34 43
C663_3959 YP_007428988.1 hypothetical protein NC_013450.8614146.p0 Protein 5e-34 43
C663_3959 YP_007428988.1 hypothetical protein NC_002951.3238224.p0 Protein 5e-34 43
C663_3959 YP_007428988.1 hypothetical protein BAC0039 Protein 3e-29 43
C663_3959 YP_007428988.1 hypothetical protein CP000034.1.gene2186. Protein 3e-29 43
C663_3959 YP_007428988.1 hypothetical protein NC_002695.1.916589.p Protein 2e-29 43
C663_3959 YP_007428988.1 hypothetical protein AF130997.1.orf0.gene Protein 8e-36 42
C663_3959 YP_007428988.1 hypothetical protein CP001918.1.gene5135. Protein 2e-27 42
C663_3959 YP_007428988.1 hypothetical protein BAC0596 Protein 5e-28 42
C663_3959 YP_007428988.1 hypothetical protein CP001918.1.gene3444. Protein 1e-28 42
C663_3959 YP_007428988.1 hypothetical protein CP001138.1.gene2239. Protein 5e-28 42
C663_3959 YP_007428988.1 hypothetical protein NC_002695.1.915041.p Protein 3e-31 41
C663_3959 YP_007428988.1 hypothetical protein AF162694.1.orf4.gene Protein 1e-32 41
C663_3959 YP_007428988.1 hypothetical protein CP000034.1.gene3834. Protein 3e-31 41
C663_3959 YP_007428988.1 hypothetical protein CP004022.1.gene3215. Protein 8e-35 41
C663_3959 YP_007428988.1 hypothetical protein CP004022.1.gene1676. Protein 9e-29 41
C663_3959 YP_007428988.1 hypothetical protein CP000647.1.gene2531. Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C663_3959 YP_007428988.1 hypothetical protein VFG1389 Protein 1e-28 45
C663_3959 YP_007428988.1 hypothetical protein VFG1390 Protein 2e-35 42
C663_3959 YP_007428988.1 hypothetical protein VFG1563 Protein 5e-32 42
C663_3959 YP_007428988.1 hypothetical protein VFG1702 Protein 5e-32 41