Gene Information

Name : KSO_018075 (KSO_018075)
Accession : YP_007446979.1
Strain : Bacillus amyloliquefaciens IT-45
Genome accession: NC_020272
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3640526 - 3641104 bp
Length : 579 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCTATTCAATTGGCGAAAGGACAGCGTGTTGATCTGACAAAAACGAACCCCGGTCTTACAAAAGCGGTGATCGGCTT
AGGCTGGGATACGAACAAGTACTCCGGAGGGCATGACTTTGACCTTGACGCGTCGGCTTTTCTTGTCGATGCCCATGACA
ACTGTGTTAATGATCTTGACTTTGTTTTCTACAATAACCTGGAACACCCGAGCGGCGGCGTCATCCATACGGGAGACAAC
CGGACGGGCGAGGGAGAGGGAGACGATGAACAAATTATCGTCGATTTCTCAAAAATACCCGCAAATATTGAAAAGATCGG
CATCACCGTCACGATTCATGATGCGGAAGCGCGCGGCCAAAATTTCGGACAAGTTTCGAACGCGTTCGTGCGCGTCGTCG
ATGAAAACAGCCAGAATGAACTGCTTCGTTTCGATTTAGGGGAAGACTTCTCAATTGAAACGGCGGTTGTCGTTTGTGAG
CTTTACCGCCATGGGGCTGAATGGAAGTTTAACGCCATCGGCAGCGGGTTTTCCGGCGGTCTGGCATCACTTTGCCGGAA
TTACGGCTTGCAGGTGTAA

Protein sequence :
MAIQLAKGQRVDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDASAFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDN
RTGEGEGDDEQIIVDFSKIPANIEKIGITVTIHDAEARGQNFGQVSNAFVRVVDENSQNELLRFDLGEDFSIETAVVVCE
LYRHGAEWKFNAIGSGFSGGLASLCRNYGLQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-53 56
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-47 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-47 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-47 54
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-51 53
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-51 53
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-51 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-45 50
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KSO_018075 YP_007446979.1 tellurium resistance protein BAC0390 Protein 2e-51 55
KSO_018075 YP_007446979.1 tellurium resistance protein BAC0389 Protein 2e-51 53